KEGG   Gallus gallus (chicken): 424633
Entry
424633            CDS       T01006                                 

Gene name
EPS15
Definition
(RefSeq) epidermal growth factor receptor substrate 15
  KO
K12472  epidermal growth factor receptor substrate 15
Organism
gga  Gallus gallus (chicken)
Pathway
gga04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    424633 (EPS15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    424633 (EPS15)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:gga04990]
    424633 (EPS15)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    424633 (EPS15)
Domain-containing proteins not elsewhere classified [BR:gga04990]
 EF-hand domain-containing proteins
  EH (EPS15 homology) domain-containing proteins
   424633 (EPS15)
SSDB
Motif
Pfam: EF-hand_4 EF-hand_1 EF-hand_7 EF-hand_5 Crescentin EF-hand_8 TMF_DNA_bd AAA_13 UIM Fib_alpha HOOK
Other DBs
NCBI-GeneID: 424633
NCBI-ProteinID: NP_001026454
CGNC: 52229
Ensembl: ENSGALG00000010543
UniProt: Q5ZMT8
Position
8
AA seq 920 aa
MAAHLSLTQLSSANPVYEKFYRQVDSANTGRVLASDAAVFLKKSGLTDLVLGKIWDLADT
DSKGILNKQEFFVALRLVACAQNGLDVSLSSLNLPVPPPRFTDTSSPLLLSGTASSDIPW
AVKLEDKAKYDAIFDSLNPVNGLLSGDKVKPVLLNSKLPVDILGRVWELSDIDRDGMLDR
DEFAVAMFLVYCALEKEPVPMSLPAALVPLSKRKPISVPGAMPLIPSSASSKDSHQSLPP
VGILAAKTPLTQWVVSPADKIKYDEIFVKTDKDMDGFVSGVEARELFLKTGLPSALLAHI
WALCDTKDCGKLSKEQFALAFYLINQKLTKGIDPPQALTPEMIPPSDRSVTLQKSAQGLN
SVADFSAIKELDTLNNEIVDLQREKNNVEQDLKEKEDTIKQRTSEVQDLQDEVKRESSNL
QKLQAQKQKAQEILNDLDEQKAKLEEQLNDIRQKCAEEAHLIAMLKAEIASQESKISAYE
DELTKAQEELSRLQQETAELEHCIESGKAQLGPLQQHLQDSQQEINSVQTKLLELKELES
NQFSWHSQPQNVLVNGTADHSSLSNSSSETANLNENAERESIAEDEQINNVSPPRNSPET
TAAAAAAEEDKETPAATVTRKEDPFDAESHPLPDIVSETSLEFFQSDPFVGSDPFKDDPF
GKIDPFGGDPFKGSDPFAADCFFKQSSTDPFVTAGTDPFSAASNSNNTTTEIPKKNDPFA
PGGTTVTASDDLATDPFASLFGNESFGSGFADFSTLSKANNEDPFSSSTSGSVKNVVITK
NSFEEPPAKNEDIPPALPPKTGTPTRPCPPPPGKRPINQIDSSDSFKPSDPFQPFPTPEI
PKEQEADLFCDPFAPTSVSKEADPNNFANFSTYSTEEDMIEWAKRESEREEKERLARLKQ
QEQEDLELAIALSKSEISEA
NT seq 2763 nt   +upstreamnt  +downstreamnt
atggccgcccacctctccctgacacagctatcaagtgcaaaccctgtgtatgagaagttc
tatcgacaggttgattctgctaatactggaagagtgttagcttctgatgcagctgttttc
ttgaagaaatctggattgacggacttggtacttggaaagatttgggacttagctgatact
gatagcaaaggaatcttgaacaaacaggagttttttgtagctttacgacttgtggcatgt
gcacagaatggattggatgtttccctgagtagtctcaatttgcccgttcctccaccaaga
tttactgataccagtagtcctttgctgctcagtggaacagcatcaagtgatataccatgg
gctgttaagctggaagacaaggccaagtatgatgctatttttgacagcctaaatcctgtt
aatggactactgtcaggagataaagtgaaacctgtactcctgaactcaaaactaccagtg
gatatcttaggacgagtgtgggaattgagtgatattgaccgagatggaatgttggatcgc
gatgaatttgcagttgccatgttcttggtgtactgcgcattggagaaagaaccagtgcca
atgtccttgcctgcagctttggtgccgctatccaagagaaaacctattagtgttccagga
gcaatgccgttaattccttcttcagcatcttccaaagattctcatcagtccttgccacct
gtaggcattttagctgccaaaacaccattaacacagtgggttgtatcgcctgcagacaaa
attaagtatgatgagatctttgtgaaaactgacaaggacatggatggatttgtgtcaggt
gtggaagccagagaactattcttgaagacaggactgccttctgctctgcttgcacatatc
tgggctctgtgtgacacaaaggattgtgggaagctttccaaggaacagtttgctttggct
ttctacttaattaatcagaaattaacaaagggcattgatccacctcaagctctgactcca
gagatgattccaccttcagacaggagtgtcacattacagaagagtgctcaaggactgaat
tctgtagcagatttttctgcaattaaagagcttgatacattgaacaatgaaatagtagac
ctgcagagggaaaagaataatgtagagcaagacctgaaggagaaagaagataccatcaaa
cagaggacgagtgaggtccaggatctacaagatgaagtaaaacgggagagcagtaacctg
caaaagctgcaagcgcagaaacagaaagcgcaggaaatccttaatgatcttgatgagcag
aaggccaagttggaagagcaactcaatgatatcaggcagaagtgtgcagaggaggcccac
ttgattgctatgctgaaagctgaaatagcaagccaggagtcaaagatttcagcatatgaa
gatgaactgaccaaagctcaagaggagctgagtcgtctgcagcaagaaactgcagagctt
gagcattgcatagagtctgggaaagcacagctgggacctcttcagcaacatctgcaagat
tcacaacaggaaatcaattcggtgcagacaaaacttcttgagctgaaagaactggaaagt
aaccaattcagttggcactctcagccacagaatgtacttgttaatggaactgcggatcat
tctagtcttagcaacagcagcagtgaaaccgctaaccttaatgagaatgctgagagggaa
agcatagctgaagatgaacaaataaacaatgtatccccacccagaaatagtcctgaaaca
acagctgctgctgctgctgcggaagaagacaaagagactccagctgcaactgttacgaga
aaagaggatccttttgatgctgaatctcatccattgcctgatatagtttctgaaacaagc
ttagagttcttccagtccgacccttttgttggcagtgatcccttcaaagatgaccctttt
gggaaaattgatccttttggtggtgatcccttcaaaggctcagatccttttgcagctgac
tgctttttcaaacagtcctccactgatccttttgtgactgcaggcactgatccatttagc
gcagcaagcaacagtaataataccacaacagagataccgaagaaaaatgatccttttgct
cctggtggaacaactgttactgcatcagatgatctagctacagacccctttgcctctctg
tttggaaatgaatcctttggaagtggctttgctgacttcagcacgctgtcaaaggccaac
aatgaggatccctttagctcttccacatcaggctctgtcaaaaatgtggtcataactaaa
aactcatttgaagagccaccagccaaaaatgaggacatccctcctgcattgccccctaaa
actggaactcccacaaggccctgtccgccacctcccgggaaaagacctatcaatcaaata
gactcttcagattcctttaaaccgagcgatccatttcagccttttcccaccccagaaatt
cccaaagaacaagaagcagatctattctgtgatccatttgctcccaccagcgtcagtaaa
gaggctgaccccaacaattttgcaaacttcagtacttattctactgaggaagacatgatt
gaatgggctaagagggaaagtgagagagaagagaaagaaagattggcaagactaaaacag
caagagcaagaagacttggaactggctattgcactcagtaaatcagaaatatcagaagca
tga

DBGET integrated database retrieval system