KEGG   Gallus gallus (chicken): 424684
Entry
424684            CDS       T01006                                 

Gene name
KANK4
Definition
(RefSeq) KN motif and ankyrin repeat domain-containing protein 4 isoform X1
  KO
K22808  KN motif and ankyrin repeat domain-containing protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gga03400]
    424684 (KANK4)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    424684 (KANK4)
SSDB
Motif
Pfam: Ank_2 KN_motif Ank_5 Ank_4 Ank_3 Ank RNase_Y_N Tropomyosin_1 SKA1 PspA_IM30 Tropomyosin CENP-Q DUF4795 Exonuc_VII_L DUF812 DUF4164
Other DBs
NCBI-GeneID: 424684
NCBI-ProteinID: XP_015146641
CGNC: 8323
Ensembl: ENSGALG00000010953
UniProt: E1C250
Position
8
AA seq 1003 aa
MEKTDAAGQPPLPNGDGEQPRSLPYSLETPYGFHLDLDFLKYVDDIEKGNTIRRVHIHRK
AKQPKFSTLPRNFSLPENGSHGYAASTGPGWPAATYRAQRKASLGAEEISRAPLPSEEPS
YRRKALLAETRRHAELVRCEDELRGRPQLLRASSLPAALPPGQAPASDGCVPCPLRPSDN
GSCPESTFRPMPRSPDGIASLPSLMLSPGAELASQQQEWPGKGGLVRDVPKERAQPLWQG
QHSAVQLQVVMESRGEEGDASDATNGSTLVSASPGALQLADESTNHGKAGGSVSEIALNV
LKEGEDRCAHAQEKKEQGGDAGEPGGIAALKQHIAALEEQLDRKKEELEQIRAVLKQQDH
KIKEKEKSIQLLASSKAQLEGQLCRENTREDAVSSMQRGSMLQCNDVAVNTELSYVNGSK
QVHDKGINVNIPLSTKSIGCGIRRADNGNLLAAELSAQGWADVGTSGGGDGHFAKLSETE
AGLEPGLHAPGFTELKIDEQLSDDNQNQRNSCDTQSLAARAAAAESYRTKRTGSSADENE
AGFGEDKTEDGMGEEGLPDPKDFPAVDPIGQYVKKIQELLQEQWMCLEHGYPELASAIKQ
PASKLSSIQNQLVNSLNSLLSAYSSQRPADKENSNTHYQQLETSSTTSLKSIMKKKGYGS
HAGGNGTKKNLQFVGVNGGYETTSSEDTSCEDSPSDGDMESDTERGAGGLEPTQEQGGGG
SEGASFVTSVQETREDDDLQEPGAETAPCTQHKADSCKPSEDFLAACQLLSQHLSEIRAT
SDQHLRHVLSTICQEWFQVSSRKSSSPEVVTAYLQALGTIQLQLLEAVVNMADRNGNTAL
HYSISHSNFTIAKLLLDTGVCRLDLPNQAGYTAVMLTPLVAAETDEDMAVVMRLLKEGDV
NVRAAQGGQTALMLGVSHEREAMVRALLACQADVNLQDEQGSTALMVACRQGSTDMVRLL
LAQPGCQLALTDKDGDTALSIAQRSAHEDIAALLHSAQHGPND
NT seq 3012 nt   +upstreamnt  +downstreamnt
atggagaagacagatgcagccggccagccacccctgcccaatggggacggggagcagccc
cgcagcctcccttactccttggaaacaccatatggcttccacctggacctggactttctc
aagtatgtggatgacattgagaaagggaacaccatcaggagggtccacatccaccgcaaa
gcgaagcagcccaaattcagcactctgccccgaaacttcagcctgcctgagaacggctcc
catggctacgcagcctccactgggcctggctggccagctgccacgtaccgtgcacagcgc
aaggcatccctgggggcagaggagatatcacgggccccactgcccagcgaggagcccagt
taccgcaggaaggctctcctggccgagacgcgacggcacgctgagctggtgcgctgtgag
gatgagctccgggggcggccgcagctgctgcgggcatccagcctgcctgcagcactgcca
cccggccaggccccggccagcgatggctgtgtgccatgtcccctccggcccagtgacaat
gggagctgcccggaaagcacgttccgtcccatgccacgttcacccgatggcatcgcctcg
ctgccatctctcatgttgagtcctggggcagagttggcctcgcagcagcaggaatggcca
gggaaaggtggccttgtgcgggatgtccccaaggagagggcacagcccctatggcagggc
cagcactctgctgtgcagctacaggtggtgatggaaagccggggcgaggagggtgatgcc
agtgatgccaccaatggtagcaccctggtctcagcctcaccaggtgccttgcagcttgca
gatgaaagcacaaaccatgggaaagcagggggaagcgtaagtgaaattgctctgaatgtg
ctgaaggaaggtgaggacaggtgtgcccatgcccaagagaagaaggagcagggaggagat
gcaggagagcccggtgggatcgctgcactgaagcagcacattgctgcactggaggagcag
ctggacaggaagaaagaagagctggagcagatcagagcagtgctgaagcagcaggatcat
aagatcaaggaaaaggagaagagcattcagttactggccagctccaaagcccagctggag
gggcagctgtgccgggagaacacacgagaggacgcggtgtcttccatgcagcgtggcagc
atgctgcagtgcaacgatgtcgcggtgaacactgaactctcatatgtgaatggctccaag
caagtccacgataagggcatcaatgtaaatatcccactttccaccaaatccataggatgt
ggcatccgcagagcggacaatggaaacttgctggcagcggagctgagtgctcagggatgg
gctgatgttggcaccagtggtggtggagatggacactttgccaagctctcagagactgaa
gctggcctggagcctggccttcacgccccgggcttcaccgagctgaagattgatgagcag
ctcagcgatgacaaccaaaaccaaaggaatagctgtgacacccagagcctcgctgctcgt
gcagcggctgcggaaagctatcgaacaaaaagaactggctcaagtgcagacgaaaatgag
gcaggctttggtgaagacaaaactgaagatgggatgggagaggaaggtctccctgacccc
aaagatttccctgctgttgaccccataggccaatatgtaaagaaaatccaggagctgctg
caggagcagtggatgtgtttggagcatggctaccctgagctggcgagcgctatcaaacag
ccggcctctaagctcagctccatccagaaccaattagttaattccttaaactcgttgctg
tctgcctactcttcgcagaggccagcagataaggagaattcaaacacgcactatcagcag
ttggaaacctcatcaaccacaagtcttaaatctatcatgaaaaagaaaggttatggctcc
catgcaggaggcaatgggaccaaaaagaatcttcagtttgttggggtaaatggtggctac
gaaacaacttcaagtgaagacacaagttgtgaagacagcccatcagatggggacatggag
agtgacacagagagaggagctggtggtctggagcccacgcaggaacaaggcggaggtgga
agtgagggagcttcatttgtgacctctgtgcaggagacacgagaagacgatgacctgcag
gaacctggggcagaaacagcaccttgcactcagcacaaggctgacagctgcaaaccctct
gaagatttcctcgctgcctgccagctgctcagccagcacctctccgaaataagggccacg
agtgaccagcatctgcggcacgtcctcagcaccatctgccaggagtggttccaggtgtca
agtcgcaagtcctccagccctgaggtggtcacagcctatctgcaggcactgggcaccatc
cagctgcagctgctggaggcagtggtcaacatggccgacaggaatggcaacacggctctt
cactacagcatctcccactccaatttcacgattgcaaagctcctgctggacacaggggtc
tgccgcctggacctgccgaaccaggcgggctacacggctgtgatgctcaccccactggtg
gctgccgagacagatgaagacatggcagtggtgatgaggctgctgaaggagggggatgtc
aatgtgcgagccgctcagggagggcagacggccctgatgctcggggtgagccacgagcgg
gaggccatggtgcgggccctgctggcctgccaggccgacgtcaacctgcaggacgagcag
ggcagcacggcgctgatggtggcctgccggcagggcagcactgacatggtcaggcttctg
ctggcccagcctggctgccagctggcgctgacggacaaggatggagacacagcgctgtcc
attgcccagaggagcgcccatgaggacatcgctgcactgctacacagtgcccagcatggc
cccaacgactga

DBGET integrated database retrieval system