KEGG   Gallus gallus (chicken): 424754
Entry
424754            CDS       T01006                                 

Gene name
POLR2D
Definition
(RefSeq) DNA-directed RNA polymerase II subunit RPB4
  KO
K03012  DNA-directed RNA polymerase II subunit RPB4
Organism
gga  Gallus gallus (chicken)
Pathway
gga03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    424754 (POLR2D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gga03021]
    424754 (POLR2D)
   03400 DNA repair and recombination proteins [BR:gga03400]
    424754 (POLR2D)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     424754 (POLR2D)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      424754 (POLR2D)
SSDB
Motif
Pfam: RNA_pol_Rpb4 Tfb4 Rop Maelstrom
Other DBs
NCBI-GeneID: 424754
NCBI-ProteinID: NP_001264338
CGNC: 1461
Ensembl: ENSGALG00000002057
UniProt: F1P2S1
Position
9
AA seq 142 aa
MAAGGSDPRTADVEEDASQLVFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV
FMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEEAKALIPSLEG
RFEDEELQQILDDIQTKRSFQY
NT seq 429 nt   +upstreamnt  +downstreamnt
atggcggcgggtggcagcgacccgaggactgcagatgtggaagaggacgcctcgcagctc
gtcttccccaaagaattcgagactgcagaaactctgctgaattcagaagtgcatatgctt
cttgagcatcgcaagcaacagaacgagagtgcagaagatgagcaggagctgtcagaagtc
ttcatgaagactctgaattacacagcacgcttcagccgcttcaaaaaccgcgagaccatc
gccagtgtccgtagcttgctgctccaaaaaaagctccataaatttgaattggcatgtttg
gccaacttgtgtcctgagactgctgaggaagccaaagctttgattcctagcctggaggga
cgatttgaagatgaggaattgcagcagattcttgacgacattcagaccaaacgcagcttc
cagtactga

DBGET integrated database retrieval system