KEGG   Gallus gallus (chicken): 424830
Entry
424830            CDS       T01006                                 

Gene name
CAB39
Definition
(RefSeq) calcium-binding protein 39
  KO
K08272  calcium binding protein 39
Organism
gga  Gallus gallus (chicken)
Pathway
gga04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    424830 (CAB39)
SSDB
Motif
Pfam: Mo25
Other DBs
NCBI-GeneID: 424830
NCBI-ProteinID: XP_003641786
CGNC: 66485
Ensembl: ENSGALG00000027262
UniProt: R4GI86
Position
9
AA seq 341 aa
MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEK
EPQTEAVAQLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYI
CTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDI
ASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDR
HNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQT
KLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPAQQEA
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgccgttcccctttggcaaatcccacaagtctcctgcagacatagtgaagaacctgaag
gagagtatggcagtgctagaaaagcaggatatatctgacaagaaggcagaaaaggcaact
gaggaggtctcaaaaaaccttgttgccatgaaagaaatcttatatggcacaaatgaaaaa
gagccacaaacagaagctgtggcacagcttgctcaggagctgtacaacagtggtctcctt
agtacccttgtagctgacttgcagctaattgattttgagggcaaaaaggatgtcgcccaa
atcttcaacaacatcctcagaaggcaaattggtacaagaactcccacagttgaatacatc
tgcactcaacagaatatattgttcatgctattaaaagggtacgaatctccagaaattgct
ctaaattgtggcataatgcttagggaatgcatcaggcacgaacctcttgctaagatcatc
ttgtggtcagaacagttctatgatttcttcagatatgtggagatgtcgacgtttgacatt
gcttcagatgcatttgccacgttcaaggatttacttacaagacacaagttgctaagtgca
gaatttttggaacagcattatgataggttcttcagtgaatatgagaagttacttcattca
gaaaactatgtgacaaagagacagtcacttaagcttcttggtgaattattattggacaga
cacaacttcacaattatgacaaaatacatcagtaaacctgaaaatctcaaactaatgatg
aaccttctacgagacaagagccgtaacattcagtttgaggcctttcacgtgtttaaggtg
tttgtagccaaccctaacaagacgcagcctatattagacatccttctaaagaaccagacc
aaactcattgagttcctcagcaagtttcagaatgacaggaccgaggatgaacaatttaat
gatgagaagacctatttagttaaacagatcagggatttgaagagaccagcacagcaagaa
gcttaa

DBGET integrated database retrieval system