KEGG   Gallus gallus (chicken): 424860Help
Entry
424860            CDS       T01006                                 

Gene name
PAK2
Definition
(RefSeq) serine/threonine-protein kinase PAK 2
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04012  ErbB signaling pathway
gga04510  Focal adhesion
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    424860 (PAK2)
   04012 ErbB signaling pathway
    424860 (PAK2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    424860 (PAK2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    424860 (PAK2)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     424860 (PAK2)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: STE group
  STE20 family
   424860 (PAK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PBD Kinase-like APH Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 424860
NCBI-ProteinID: XP_004937052
CGNC: 4842
Ensembl: ENSGALG00000006426
UniProt: E1BS97
Position
9
AA seq 521 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSYGGKDPLSANHSLKPLPSVPEERKPRNKIISIFSSTEKGS
KKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVL
DVLKFYDSKDTAKQKYLSFSAPEKDGFPSGTPTTNAKGSEPSTAVADDDDDDEEAPPPII
APRPDHTKSIYTRSVIDPIPAPAGDASVDGGTKSGDKQKKKTKMSDEEIMEKLRTIVSIG
DPKKKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKN
PNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQ
VIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPK
VDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEM
DVEKRGSAKELLQHPFLKLAKPLSSLTPLILAAKEAMKSNR
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaacggagaactggaagacaagccaccagctcctcctgtgcggatgagcagt
tatgggggaaaggacccgttgtctgccaaccacagcttgaaacctctgccctccgtacca
gaagagagaaaacctaggaataaaatcatctccatattctctagcactgaaaaaggaagc
aagaagaaggaaaaggaacgaccagaaatctccccgccgtcagactttgagcatactatc
catgttggctttgatgctgtcactggagagttcactggaatgccagagcaatgggctcgg
ttgctacagacctcaaacatcaccaagttagaacagaagaaaaaccctcaggcggtacta
gatgtgctgaaattctacgactccaaagacacagcaaaacagaaatatctgagcttttct
gctccagaaaaagatggcttcccttcaggaacaccaacgaccaatgccaaaggttcagag
ccatcaacagctgtggcagatgacgatgacgatgatgaagaagcacctcctcctattatt
gctccgcggccagatcacacgaaatcgatttatacacggtctgtaattgaccccatccct
gcaccagctggtgacgcttctgttgatggtgggacaaagtcaggtgataagcagaaaaag
aagaccaaaatgtcagatgaagagatcatggaaaaactacgtaccattgtgagcataggt
gatcccaagaaaaaatacaccagatatgaaaaaattgggcagggggcttcaggtacagtt
ttcacagctattgacgtggctactgggcaggaggttgctatcaaacagataaacctgcag
aaacagcccaagaaggagttgattattaatgagatcttggtaatgaaggaactaaagaac
cccaacatagtcaacttcctggacagttacctcgtaggagatgaactgtttgtggtgatg
gagtatctagctggaggctcactaacagatgtggttacggaaacatgtatggatgaagca
cagattgctgctgtttgcagggagtgcttgcaagcgcttgagttcctccatgccaaccag
gtcatccacagagatataaagagcgacaacgtgctgctaggaatggatggatcagttaaa
ctaaccgactttggtttctgtgctcagatcaccccagagcagagcaagcgcagcactatg
gttggaacaccttactggatggctcctgaagtcgtcacacggaaagcctatggccctaaa
gtggatatctggtccctaggcatcatggctattgagatggtggaaggagaacccccgtac
ctcaatgaaaaccccctgagggcgttatatttgatagcaactaacggcacaccagagctt
cagaaccctgagaaactgtccccaatattccgggatttcttaaaccgatgtttggagatg
gatgttgagaaaagaggatcagccaaagaattgctacagcatcccttcttgaaattggcc
aaacctctgtctagcttgacgccactgatcctggcagccaaagaagcaatgaagagtaac
cgctaa

DBGET integrated database retrieval system