KEGG   Gallus gallus (chicken): 424910Help
Entry
424910            CDS       T01006                                 

Gene name
CLDN1
Definition
(RefSeq) claudin-1
  KO
K06087  claudin
Organism
gga  Gallus gallus (chicken)
Pathway
gga04514  Cell adhesion molecules (CAMs)
gga04530  Tight junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    424910 (CLDN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    424910 (CLDN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    424910 (CLDN1)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   424910 (CLDN1)
  Exosomal proteins of colorectal cancer cells
   424910 (CLDN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF4134 CD20 DUF981 OppC_N L6_membrane DUF2157
Motif
Other DBs
NCBI-GeneID: 424910
NCBI-ProteinID: NP_001013629
CGNC: 66478
Ensembl: ENSGALG00000026862
UniProt: Q5ZMG2
Position
9
AA seq 211 aa AA seqDB search
MASGGLQLLGFVLAFLGWMGIIISTAMPQWKMASYAGDNIVTAQALYEGLWMSCAMQSTG
QIQCKVYDSLLKLEGSLQATRALMVAAILLGLVGVFVAVTGMKCMKCMEDDQVKKMRMAV
FGGVIFIIAGLSALVATSWYGNRVARAFYDPFTPVNTRFEFGSALFIGWAAASLALLGGA
FLCCSCPRSETSYPPSRGYPKNAPSTGKDYV
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgggggcttgcagctcctgggcttcgtgctggccttcctcggctggatgggt
atcatcatcagcaccgccatgccccagtggaagatggcatcgtacgcgggggacaacatc
gtgacggcccaggcgctctacgaggggctgtggatgtcgtgcgccatgcagagcacgggg
cagatccagtgcaaggtgtacgactcgctgcttaagctggagggcagcctgcaggccaca
cgggccttgatggtggccgccatactcctgggtctggttggtgtgtttgttgctgtgacg
ggcatgaagtgcatgaagtgcatggaggatgaccaggtgaagaagatgcggatggctgtc
tttggtggcgtgatcttcatcattgcaggtctgtcagcactggtggccacgtcatggtat
ggcaacagagtggctcgggccttctatgaccctttcacacccgttaacaccagatttgag
tttggatcagccctcttcattggctgggcagccgcttctctggcattgctggggggagca
ttcctctgctgctcctgcccccggagtgaaacatcctacccacccagccgaggctacccc
aaaaatgccccctccacagggaaggattacgtataa

DBGET integrated database retrieval system