KEGG   Gallus gallus (chicken): 424954
Entry
424954            CDS       T01006                                 

Gene name
POLR2H
Definition
(RefSeq) DNA-directed RNA polymerases I, II, and III subunit RPABC3 isoform 1
  KO
K03016  DNA-directed RNA polymerases I, II, and III subunit RPABC3
Organism
gga  Gallus gallus (chicken)
Pathway
gga03020  RNA polymerase
gga04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    424954 (POLR2H)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    424954 (POLR2H)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gga03021]
    424954 (POLR2H)
   03400 DNA repair and recombination proteins [BR:gga03400]
    424954 (POLR2H)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     424954 (POLR2H)
  RNA polymerase III system
   RNA polymerase III
     424954 (POLR2H)
  RNA polymerase I system
   RNA polymerase I
     424954 (POLR2H)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      424954 (POLR2H)
SSDB
Motif
Pfam: RNA_pol_Rpb8 RNA_pol_RpbG
Other DBs
NCBI-GeneID: 424954
NCBI-ProteinID: NP_001264394
CGNC: 6474
Ensembl: ENSGALG00000008534
UniProt: E1BSD8
Position
9
AA seq 150 aa
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF
NT seq 453 nt   +upstreamnt  +downstreamnt
atggccggcatacttttcgaggacatcttcgatgtgaaagatatcgaccccgagggcaag
aagttcgaccgtgtgtctcgcctgcactgcgagagcgagtccttcaagatggacctcatc
ctggacgtcaacatccagatctaccccgtggacctcggtgacaaattccgtttggtcatt
gccagcaccctgtatgaggatggcacattggatgatggggagtacaaccctacagatgac
aggccctccagggcagaccagttcgagtacgtgatgtatggcaaggtgtacaggattgag
ggggatgagacatccacagaggcagccacgcgcctctctgcttatgtgtcctacgggggg
ctgctcatgcgccttcagggagacgcaaacaatctgcatgggtttgaagtggactccaga
gtttacctgctgatgaagaaattggccttctag

DBGET integrated database retrieval system