KEGG   Gallus gallus (chicken): 424959
Entry
424959            CDS       T01006                                 

Gene name
MCF2L2
Definition
(RefSeq) probable guanine nucleotide exchange factor MCF2L2 isoform X1
  KO
K20685  guanine nucleotide exchange factor MCF2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    424959 (MCF2L2)
Membrane trafficking [BR:gga04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    424959 (MCF2L2)
SSDB
Motif
Pfam: RhoGEF PH CRAL_TRIO_2 PH_10 Spectrin
Other DBs
NCBI-GeneID: 424959
NCBI-ProteinID: XP_004943494
CGNC: 6637
Ensembl: ENSGALG00000008744
Position
9
AA seq 1285 aa
MASRCRKCGQQVPRNLPFTAVRITEGEMKSYHDFIGGCIRLECMAKKDEIMQQEIRPLVA
VDIIEQLHRQFAILSGGRGKDGAPIITFPEFAGFSEIPDEDFLNVVTYLTSIPSLEAASI
GFIIIIDRRRDKWSAVKASLTRIAGAFPGNLQLVFVLRPSRFIQRAIADIGIKLYRDDFK
MKVPIIMLNSVSDLHGYIDKCQLTRELGGTLEYGHSQWIHHRTAIENFAMTVKTTAQMLQ
TFGTDLAETELPNDVQCTEELLSAHTDHHSKLKDELKLAVKQGATLLTCIREPVTRSANS
KLSPDELENVATVERLLAQLDETEKAFDQFWTKHHLKLEQCLQLRHFEHDFREVKLTLDN
LMEAQAGFSDVGDSVTRVEHLLREQKQLEEKGQEPLEKAQTLALHGEQLIQNNHYAVDSI
RPKCVELRRICDDFTNETKKKYDILGKSLELHKQLDKASQWCEAGIYLLASQAVDKCQSQ
EGAETALVEIEKFLATAKEHQLSNPKEFYNQFDTILTPEIKANAQRILQKLEDVQEMFDK
RQVSLKKLAAKQTRPVQPVAPHPESSPKRASPKTTRPAGVATNRRSAEITCPPKSISEAE
LSKKKSIKKTKGGIKIEVMHEASQGGSSRVLVMSESDENLSTRRSHIINELIETERVYVE
ELQSIIEGYASEMDNPSLLHLIPSVLQNKKDILFGNLPEIYEFHNRIFLKELENCIENPE
LLARCFLKRKEDLQIYEKYCQNKPRSEALWRQCGDSIFFQECQRKLDHKLSLDAYLLKPV
QRITKYQLLLKEMLKCSKNSEGTAELEEALATVLDIIKSVNDSMHQIAITGYEGDVSELG
KLLMQGSFNVWTDHKKGHNKVKDLARFKPMQRHLFLYTKMLLFCKKREENTDGHEKTASY
SFKNSLKMSTVGITENVKGDNKKFEIWYNGREEVYIIQASSVELKNTWISEIRKVLTGQL
EACREASQLHQRITESVYHAPMNSSNITRYSRKSSSIYENKSETSNVEASNNKNRNSSPS
ARQKRVDASTSLNLERTALARKRFTLQGLSNRRAPPKDPESKEREVARRFSLASSISTTV
NASAVTKGPLVPAVKVKRHEIKSDPTPLGFEDAFENTILAQTKCSTGSTTRPVPRSASQT
GWPSRQMPSLDTFEDFEAIPSSMDELSNSSDMEEETNPNNGTNLFRVEGSFDSCFPDSLT
LEDGDLVQFVQEGENGQWLVKKLVSEKSEWVPSSILQPAEGDTNNIIKNSNADMYNDSCS
TASVESDTKESEVAKSFPAEQRAGS
NT seq 3858 nt   +upstreamnt  +downstreamnt
atggcttctcggtgtcggaaatgtggacaacaggtgcccaggaatctacctttcactgct
gttcggataacagagggagaaatgaaatcttaccatgatttcataggaggatgcattaga
ctggagtgtatggcaaagaaagatgaaatcatgcagcaggagatacgaccgctggttgca
gtggatataatagaacagctacacaggcaatttgctatcttgtcaggaggaagagggaag
gatggagcgccaattattaccttcccagagtttgcaggattcagtgaaatacccgatgag
gattttctgaatgtggtcacgtacctaaccagcattcccagtctggaggctgccagcatt
ggattcatcatcatcatagacagacgacgagacaaatggagcgcagtcaaggcatccctg
acacggatagcaggagcatttccaggaaacctacagctggtgtttgtcctgcgtccctca
cgctttatccaaagggcaatcgctgacattggcattaaactctatcgagatgactttaaa
atgaaggtaccgatcatcatgctaaattctgtctctgatcttcatggctatattgataaa
tgtcaactgacccgggagctgggaggaaccctggagtacggccacagtcagtggatacat
caccgaactgctattgaaaactttgcaatgacagtgaaaacaacagcacagatgctacag
acctttggaacggacttagcagagactgaacttcccaatgatgtgcagtgtacagaggag
ctcctatctgcacacactgaccaccatagcaagctgaaggatgagctgaaactagctgtg
aagcagggggccacactactgacgtgcattagggagccagtcacccgaagtgccaacagc
aagctcagtccagatgaactggaaaacgtggcaacagtggaaaggttgttggctcagttg
gatgaaacagaaaaggcttttgatcaattttggaccaagcatcacctaaaactagaacaa
tgcttgcagcttcgacactttgaacatgattttagagaagtaaaattaacattggataat
ctcatggaagcacaagctggtttttctgacgttggagacagtgtgactcgagtagaacac
ctcctaagggaacagaagcaactggaagaaaaagggcaggaacctttggagaaagcccag
actctagctctccatggagaacagctcatccaaaacaaccattatgcagttgactccatt
agaccaaagtgtgttgaactcaggcgtatttgcgatgactttactaatgagaccaagaaa
aagtatgatattttggggaagtctcttgagctgcataagcaattagataaggcaagccaa
tggtgtgaagctggaatctacctcttagcttcccaagctgtggacaagtgccagtcacaa
gagggagctgaaactgcactcgttgaaatagagaagttcctggcaacagcaaaggagcac
caactctctaacccaaaggagttctacaatcagtttgacacgattctcacacctgaaata
aaggccaacgcccaaaggattttacaaaagctagaagatgtacaagagatgtttgacaag
aggcaagtgagtctgaagaagctagcagccaaacagacccgtccagtgcaacctgttgcc
ccacatcctgaatcttccccaaaacgagcatcaccaaagactaccagaccagcaggagta
gctaccaacaggaggtccgcagaaattacttgtcctccaaagtccatctctgaggcagag
ttatcaaaaaagaaaagcattaagaagactaaaggtggaattaagattgaagtgatgcat
gaagcgagccaagggggatctagcagagtcttggttatgagtgaaagcgatgagaacctg
tcgacgaggaggagccacataatcaatgagctgatagaaaccgaacgcgtttatgtggaa
gaacttcaaagcataatagagggatatgcttcagaaatggacaatccaagtttattacat
ctgattccatcagtgctccagaacaaaaaggatattctatttgggaacctcccagaaatc
tatgaattccacaacaggattttccttaaagagttagaaaattgcattgaaaatcctgag
ctccttgcccgatgctttttgaaaaggaaagaggaccttcaaatatatgaaaaatactgt
cagaacaagccaaggtctgaagctctctggagacagtgtggagacagcatcttttttcag
gaatgtcagcgtaaattggatcataagctctcactagatgcgtatcttttaaagccagtc
cagagaatcaccaagtaccagctactattgaaggaaatgctgaaatgtagcaagaattca
gaaggtactgctgaactggaagaggccttggccacagtgcttgatatcatcaaatccgta
aatgactccatgcaccagatagcaatcacaggatatgagggggacgtaagtgagcttggt
aagctgttgatgcaaggttccttcaacgtgtggactgaccacaagaagggtcacaacaag
gtgaaggacttggcaagattcaagccgatgcagagacacctcttcctctacacaaagatg
ctgcttttttgcaagaaacgagaggaaaacacagatggtcatgagaagacagcttcatac
agctttaaaaattcattaaagatgagcacagtgggcatcacagaaaatgtaaaaggagac
aacaagaagtttgagatctggtataatggcagagaagaagtctatatcattcaggcatct
tctgttgaactgaaaaacacttggatttccgagatacgcaaagttctaacaggacaactg
gaagcatgtagagaagcaagtcaactacaccaaagaatcaccgagagtgtgtaccatgca
ccaatgaattcctccaatataaccaggtatagcagaaagtcgtcaagcatatatgaaaac
aaatccgagacatcaaacgtggaagcatctaacaataaaaacaggaattccagtcccagt
gccagacaaaagagagttgatgcttccaccagccttaaccttgagcgcacagcgcttgct
agaaagcgattcacattgcaaggtctttccaaccgcagagctccacccaaagatccagaa
tctaaggaaagagaagttgcccgtcgcttttccctagcctcctccatcagcactacagtt
aatgcatctgctgtgaccaaaggtccccttgttcctgcagttaaagtcaagagacatgaa
ataaagagtgacccaactcccctggggtttgaagatgcttttgagaacaccatattggcc
cagactaaatgtagcactggttccaccacaagacccgtacctagatctgcttcacagaca
ggttggcccagtaggcaaatgccatctctagacacatttgaagactttgaagccattcct
tccagcatggatgaactctccaactcttcagacatggaggaagaaaccaaccctaacaat
gggaccaatctttttcgagtagaaggcagttttgacagctgtttcccagattctcttaca
cttgaagatggagatctagtgcagtttgtgcaggaaggagaaaatgggcaatggttagtg
aagaaattggtctcggagaaaagtgaatgggttccttccagtatattgcagccagcagag
ggggacactaacaacataattaagaacagcaatgcagacatgtacaatgattcctgcagc
acggcttcagttgagtcggacaccaaggagagtgaggtggctaaaagcttcccagcagaa
cagagggctggcagctga

DBGET integrated database retrieval system