KEGG   Gallus gallus (chicken): 424997
Entry
424997            CDS       T01006                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus protein isoform X6
  KO
K04462  ecotropic virus integration site 1 protein
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    424997 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    424997 (MECOM)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    424997 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 zf-C2H2_11 zinc_ribbon_15 SET PyrI_C
Other DBs
NCBI-GeneID: 424997
NCBI-ProteinID: XP_004943561
CGNC: 7174
Ensembl: ENSGALG00000032577
Position
9
AA seq 1137 aa
MQCFKTWLQFQAPDPSWSVLQILDEFCNVKFCIDASQPDVGNWLKYIKFAGCYDQHNLVA
CQISDQIFYRVVADIEPGEELLLFMKSEDYSHETMAPDIHEERQYRCEDCDQLFESKAEL
VDHQKFPCSTPHSAFSMVEEDFQKKLENENDLRDVHEIQECKECDQVFPDLQSLEKHMLS
HSEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKQVFTDPSNLQRHIRSQHV
GARAHACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRT
QIKCKDCGQMFSTTSSLNKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMNHAN
PGLADYFGANRHPAGLTFPTAPGFSFSFPGLFPSGLYHRPPLLPTSSPVKGLPSADQTNK
SQSPLMTNPQILPATQDILKALNKQPSVGENKPVELQPERSSEERPHEKLSDQSESSDLD
DVSTPSGSDLETTSGSDLESDIESEKEKFKENGKMFKDKVSSLQSLASINNKKEHSNHSI
FSPSLEEQTAVSGAVNDSIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAF
SQSMYPFPDRDLRPLPLKVEPQSPSELKKIPKGSSESPFDLTTKRKEEKPVTPIPSKPAA
PPAASQDQPLDLSMGSRSRASSTKQAEPRKNHVFGEKKGGDLEQRKTSEASLQHARPTPF
FMDPIYRVEKRKLTDPLEALKEKYLRPSPGFLFHPQFQLPDQRIWMSAIENMAEKLESFS
ALKPEANEMIQSMPSMFNFRAPPSALPETLLRKGKERYTCRYCGKIFPRSANLTRHLRTH
TGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENG
NMSGTATSSPHSELESTGAILDDKEDSYFTEIRNFIGNSNHNNQSPRNSEERMNGSHFKD
EKAMVTSQNSDLLDDEEAEDEVMMDEEDEESEIAGKTVKEPVTSDIHEGTPEEDYEETST
LDMNCKASPGRYKEEEYNKTGLSALDHIRHFTDSLKMRKMEENQYSEAELAAFNTSQLPE
DLKQPLYRKSKSQAYAMMLSLSDKDSLHSASHNSPNMWHSMARAAAESSAIQSISHV
NT seq 3414 nt   +upstreamnt  +downstreamnt
atgcaatgctttaagacctggttgcagtttcaagctccagatccaagctggtcagtgctg
cagatcttggatgagttttgcaatgtgaagttctgcatagacgccagccaaccagatgta
ggaaactggctcaaatacatcaagtttgctggatgctacgatcagcacaaccttgttgca
tgtcagataagtgatcagatattctacagagtagtggcggacattgagccaggagaggag
ctattactgttcatgaagagtgaagattattcacatgaaacaatggctccggacattcac
gaggagcgccagtatcgctgcgaggactgcgaccagctctttgagtccaaggctgagctg
gtggaccaccagaagttcccctgcagcacaccacactccgccttctccatggtggaggag
gacttccagaaaaagcttgagaatgagaatgaccttcgggatgtgcatgaaatccaggag
tgtaaagagtgtgatcaagtcttcccagacttacaaagcctggagaagcacatgctgtcc
cacagcgaggagcgggagtacaagtgcgaccagtgccccaaagctttcaactggaagtcc
aacttgatacggcaccaaatgtcgcatgacagcggcaagcactacgagtgtgagaactgt
gccaagcaggttttcacggaccccagcaacctccagaggcacattcgttcccagcatgtt
ggggctcgtgctcacgcttgtccagagtgtggcaaaacctttgccacatcttcaggcctc
aaacagcataaacacatccacagcagtgtcaaaccctttatatgtgaggtctgccataaa
tcctatactcagttttcaaacctttgtcgtcataagcgcatgcatgctgattgcagaacc
caaatcaagtgcaaagactgtggacaaatgttcagcactacgtcttccttaaataaacac
aggagattttgtgagggcaagaaccattttgcagcaggaggattttttggccaaggcatt
tcacttcctggaaccccagctatggataaaacgtccatggttaatatgaatcatgcaaat
ccgggccttgctgactattttggagccaataggcatcctgctggtcttacctttccaaca
gctcctggattttcttttagcttccccggtctgtttccttcaggcttgtaccacaggcca
cctttgctacctactagctctcctgttaaaggactaccaagcgcagatcagacaaacaaa
agtcaaagtcccctcatgaccaaccctcagatactgccagccacccaggatattttgaag
gcactaaataagcaaccatctgtaggggaaaataagccagtggagcttcaaccagagagg
tcctctgaagagaggccgcatgagaaactcagtgaccagtcagagagtagtgaccttgac
gatgtcagtacccccagtggcagtgacctggaaaccacctctggctctgatctggaaagt
gacattgaaagtgagaaagagaaatttaaagaaaatggtaaaatgttcaaagacaaagta
agctctctgcagagtttggcttcaataaataataagaaagaacacagcaatcattccatt
ttctcaccatctttagaggagcagactgcggtgtcaggagcggtgaatgattctataaag
gctattgcttctattgctgaaaaatactttggttcaacaggacttgtggggctgcaagac
aaaaaagttggagccttaccttacccttccatgtttcccctcccattttttccagcattc
tctcaatcaatgtatccatttcctgatagagacttgagaccgttacccttgaaagtggag
ccccaatcacccagtgaactcaagaagatcccaaagggaagctctgagtctccctttgac
ctcaccactaagcgtaaggaggagaagcccgttactcccataccctcaaagccagcagct
ccgcctgcggcaagccaggaccagcctctagatctgagcatgggcagtagaagtcgagcc
agcagcacaaaacaggccgagccccggaaaaaccacgtctttggtgagaagaaaggaggt
gacctcgagcagaggaaaacgtcggaggcctctttgcagcacgcccgaccaactcccttc
tttatggatcccatttacagagtagagaaaagaaagttaactgacccacttgaagcttta
aaagagaaatacttgagaccttccccgggattcttgtttcatccacaattccaattgcct
gatcaaagaatttggatgtcagctatagagaacatggccgaaaagctggagagtttcagt
gccttgaagccagaggccaatgagatgatccagtcaatgccatccatgttcaacttccga
gccccaccaagtgctctgcctgagaccctcctgcgcaagggcaaggagcgctacacctgc
agatactgtggcaagatattccccagatctgcaaacctaacccgtcacctgaggacgcac
actggagagcagccctacagatgcaaatactgtgacaggtcctttagcatatcttccaac
ctgcagagacatgtccgtaatatccacaataaagagaagccattcaagtgtcacttgtgt
gacaggtgttttggtcaacaaaccaatcttgacagacatctaaaaaagcatgagaatggc
aacatgtctggtactgcaacatcttcacctcactcagaactggaaagcacaggggccatc
ctagatgacaaggaagattcttacttcacagaaattaggaattttattggaaacagcaac
cacaacaatcaatccccccgaaactcagaggagagaatgaatggcagccactttaaggat
gaaaaagccatggtaaccagccagaactcagatttgttggatgacgaagaggcagaagat
gaagtaatgatggatgaagaagacgaagagagtgaaatcgcagggaaaacagtcaaagag
cctgttacaagtgacatacacgaggggactcctgaggaggattacgaggaaacgagtact
ttggacatgaactgcaaagcttcccctggcaggtataaagaggaggaatataataagact
ggactttcagctttggaccacataaggcacttcacagatagcctcaaaatgaggaaaatg
gaagaaaatcaatatagtgaagctgaattggcagctttcaatacttcccagctgccagag
gacctaaaacaaccattgtacaggaaatccaaatcccaggcatacgccatgatgctctct
ctctctgacaaggactcccttcattctgcatcccataattctcccaatatgtggcacagc
atggcgagagctgctgcagaatccagcgccatccaatccatcagtcacgtatga

DBGET integrated database retrieval system