KEGG   Gallus gallus (chicken): 425003Help
Entry
425003            CDS       T01006                                 

Gene name
PDCD10
Definition
(RefSeq) programmed cell death protein 10
  KO
K18269  programmed cell death protein 10
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    425003 (PDCD10)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   425003 (PDCD10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1241 FH2 CENP-L CREPT Med11 SabA_adhesion DUF5344 GCN5L1 SesA Syntaxin_2 TFIIF_beta
Motif
Other DBs
NCBI-GeneID: 425003
NCBI-ProteinID: NP_001006554
CGNC: 7206
Ensembl: ENSGALG00000009477
UniProt: Q5ZIV5
Position
9
AA seq 212 aa AA seqDB search
MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQ
DIIMKILEKKSVDVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDE
INDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKT
YFKDGKAINVFISANRLIHQTNLILQTFKTVA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgacaatggaagagatgaagaatgaagcagagaccacttctatggtttccatg
ccactctatgctgttatgtaccctgtctttaacgagctagaaagagtaaatctgtctgca
gctcagacactgagagcagcttttattaaggctgaaaaagaaaatccaggcctcacacag
gacattattatgaaaattctggagaaaaaaagtgtggatgtgaactttacagagtctctc
ctacgtatggcagcggatgatgtagaagaatatatgattgaaagaccagaaccagaattc
caagatctgaatgaaaaggcgcgagcacttaaacagatccttagtaagattccagatgag
atcaatgacagggtgaggtttcttcagacaatcaaggatatcgccagtgcaataaaggaa
cttcttgacacagtaaataatgtcttcaagaaataccaataccagaaccggagggcactt
gagcaccaaaagaaagagtttgtaaaatactccaaaagtttcagcgatactctgaaaacc
tattttaaagatggaaaggcaataaatgtgttcattagtgccaaccgactaattcatcaa
accaacttgatactccagaccttcaaaactgtggcctga

DBGET integrated database retrieval system