KEGG   Gallus gallus (chicken): 425058Help
Entry
425058            CDS       T01006                                 

Gene name
SARNP
Definition
(RefSeq) SAP domain-containing ribonucleoprotein
  KO
K18732  SAP domain-containing ribonucleoprotein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    425058 (SARNP)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     425058 (SARNP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAP Tho1_MOS11_C LETM1
Motif
Other DBs
NCBI-GeneID: 425058
NCBI-ProteinID: NP_001026495
CGNC: 52328
Ensembl: ENSGALG00000030342
UniProt: Q5ZLP5
Position
33
AA seq 210 aa AA seqDB search
MAAETVELHKLKLAELKQECLARGLEAKGNKQDLINRLQAYLEEHAEEEANEEDVLGEEI
EEEEQKPAEPPTKVEEPPVKSPDVSTEKKVVKITSEISQMERMQKRAERFNVPVSLESKK
AARAARFGLATVSTKGLSADSKPTVNMDKLKERAQRFGLNVSSLSKKSEEDEKLKKRKER
FGIVTSSAGAGATEDTEAKKRKRAERFGIV
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggagactgtggagctccacaagttgaagttggccgagctgaagcaggaatgc
ctcgcccgtgggctggaggcgaagggcaacaagcaggacctgatcaacaggctgcaggcc
tacctggaggagcacgctgaagaagaagcaaacgaagaggatgttctgggagaagaaata
gaggaagaagagcagaaaccagcagagccacccaccaaagtagaagagcctcctgtaaaa
tcgcctgacgtgagcacggaaaagaaagtagtgaaaataacgtcagaaatctcgcagatg
gagagaatgcagaagagggctgagcgcttcaacgtgcccgtgagcctggagagcaagaag
gcagcgcgtgcagctcggtttggtttggccacagtttcgacaaaaggcctctctgcagac
agcaaacctacggtaaacatggataaattaaaggaaagggctcagagatttgggttgaat
gtctcttcgctctccaagaagagcgaagaggacgagaaactgaagaagaggaaggagcgg
tttggcatcgtgacgagttcagccggggctggagccacagaggacacagaggcaaagaag
aggaaaagagcagagcgcttcgggatcgtctga

DBGET integrated database retrieval system