KEGG   Gallus gallus (chicken): 425232
Entry
425232            CDS       T01006                                 

Gene name
CCDC83
Definition
(RefSeq) coiled-coil domain-containing protein 83 isoform X1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Acyl-CoA_dh_C
Other DBs
NCBI-GeneID: 425232
NCBI-ProteinID: XP_015136260
CGNC: 9997
Ensembl: ENSGALG00000013247
Position
1
AA seq 411 aa
MEEKKVKPEEQSAEESAFQEALLEFQIEKKEAATDKVLFDLKQVEKKNKEYNERNDKLKE
EQQAHIRRILRRIEEKEQEKDAKEVVTRNDVEESLKDKWQYAKDKEQILKDLLFRTEETD
QRLLVKQSERDYWLDYKNVGSKTDANKIKSLKKDIKEVKDDFQRTAEYYRNALKAMKEEN
DSLIEMHVKKNKEQAPENAVRYLDKCSCREIEENEWLKEEVKLYRKEVRDLKASVQLLEE
ENISLVRKLMDNKIQNLRVPRHLFLTQAADLQDESLQDEIKGVEHGEYSAETDGEESLRR
ATVSCQKKKSFPKIQCKTEIGKSQDRDEELQEKSLTPILNSLFEVERDFQEYLKLGPLVS
NPMCVVGRAMPIHKESEETPSKSPPKGDYIGESDRHITAQMIKALSKEKVG
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggaagagaagaaggtgaaaccagaagagcaaagtgcagaagaatcagctttccaggaa
gccctactagaatttcaaattgagaaaaaagaagcagcaactgataaggttttgtttgat
ttgaaacaagtggaaaaaaagaacaaagaatataatgaaagaaatgacaagctgaaggaa
gaacagcaggcacacatcagacgtatactaagaagaatagaagaaaaggagcaagaaaaa
gatgcaaaggaggttgtaactaggaatgatgtggaagaatcactgaaagacaaatggcaa
tatgctaaggacaaagaacaaattctgaaagacctgctcttccgaacagaagaaactgac
caacgacttttggtaaagcagagtgagagggattattggttggactacaaaaatgtagga
agtaaaacggatgccaacaagattaagagtctgaaaaaagacatcaaggaagtcaaagat
gactttcagaggactgcagaatattacagaaatgctttgaaagcaatgaaagaagagaat
gatagcctgattgagatgcacgtgaaaaaaaataaggaacaggccccagagaacgctgta
agatacttagacaaatgcagctgcagagaaattgaagagaatgagtggctaaaggaagag
gttaaactgtaccgaaaggaagtgagagatttgaaagcctctgttcagctcctggaagaa
gaaaatatcagtttagtgagaaaactgatggataacaaaattcagaacctgagagtaccc
aggcatttgtttcttactcaggcagctgacttgcaagatgaatctctccaggatgaaatt
aaaggagtagagcatggagagtactcagcagagactgatggagaagaaagcctcaggaga
gccacagtctcctgtcagaaaaagaagtcctttccaaagattcagtgtaaaacagagatt
gggaaatcacaggaccgggatgaagagctgcaagaaaagtcattgactcccattcttaat
agcttgtttgaagttgaaagagatttccaggaatacttaaaattgggtcctctggtgtca
aacccaatgtgtgtggttggaagagccatgcctattcataaagaatcggaagaaacacca
agcaagagccccccaaaaggcgactatattggtgaatctgacaggcacatcacagctcag
atgatcaaggccttatctaaagaaaaggttggttaa

DBGET integrated database retrieval system