KEGG   Gallus gallus (chicken): 425613Help
Entry
425613            CDS       T01006                                 

Gene name
MARS
Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00450  Selenocompound metabolism
gga00970  Aminoacyl-tRNA biosynthesis
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    425613 (MARS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    425613 (MARS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gga01007]
    425613 (MARS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gga03016]
    425613 (MARS)
Enzymes [BR:gga01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     425613 (MARS)
Amino acid related enzymes [BR:gga01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   425613 (MARS)
Transfer RNA biogenesis [BR:gga03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    425613 (MARS)
 Prokaryotic type
   Other AARSs
    425613 (MARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 WHEP-TRS tRNA-synt_1 Anticodon_1 GST_C_2 GST_C_3 GST_N_3
Motif
Other DBs
NCBI-GeneID: 425613
NCBI-ProteinID: NP_001244301
CGNC: 52512
Ensembl: ENSGALG00000039315
AA seq 888 aa AA seqDB search
MRLRVAAGSPAALKVVAAAHCAGAPVQLCWAEPGEPPPSPLCPPWAPALQLESGAVLFSP
NAICQYFFLRRGEQPTDLTTQWLEWEATELQPAALAALYAHLVHGRTGVEALGEPLGHIE
RSLVGRGTAYLAGDTESVADVVVWSTLFPVLRDEAIPAAEPLQSWFRSMTFSEACRNAAD
TVLLPRHLQEFTACLQKLPLPRPPPDTAPGCEEDDVSERALTEEDMAAAVDAWTRGAAAL
PKPWRPPKPVLPVEGMRNVLITSALPYVNNVPHLGNIIGCVLSADAFARYCRLRNWNTLY
VCGTDEYGTATETKAVEEGLTPREICDKYHAVHADIYRWFDISFDYFGRTTTPQQTVISQ
DIFQRLQAHGFVLQDTVQQLHCASCQRFLADRFVEGICPFCSYQEARGDQCDKCGKLINA
VELKTPRCKLCSGSPTVRPTQHLFLDLPKLEERLQPWLENCWATGNWTANARYITRSWIR
DGLRPRCITRDLQWGTPVPLDGFRDKVFYVWFDAPIGYLSITANYTEHWERWWKNPQQVE
LYNFMAKDNVPFHSVVFPCSLLGTDDNYTLVNHLIATEYLNYEDGKFSKSRGVGVFGDMA
KDTGIAADVWRFYLLYVRPEGQDSAFSWGDLMLKNNSELLNNLGNFINRAGMFVCKFFGS
AVPPMVLTPDDHRLLARVTVELRQYHQLLERVRIRDALRCVLNISRHGNQYIQVNEPWKR
IKGGEEDRQRAGTVTGVAVNVAALLAVLVQPYMPTVSAAIQAQLCVPPECSVLSHIFTCT
LPPGHRVGTVWGQHRGWREEGGGGGETPHPPPQLDPPSVPGKTPPDPSRIQELTEQVAKQ
GNCVRQLKASGSDRARIDSEVGKLLALKRELALAQNMSPDGPRGKGKK
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgcgggtggcggcaggcagtcccgcggcgctgaaggtggtggcggccgcacac
tgcgccggcgctccggtgcagctctgctgggccgagcccggagagccgccgccgtccccg
ctgtgtcccccatgggcccccgccctgcagctggagagcggcgcggtgctcttctccccc
aatgccatctgccagtacttcttcctgcggcgcggcgagcagcccaccgacctgaccacc
caatggctggagtgggaggccaccgagctgcagcctgccgcgctggcggccctgtatgcc
cacctggtgcacggccgaacgggcgtggaggcgctgggggaaccgctgggccacatcgag
cggagcttggtggggagaggcacggcgtacctggccggggacactgagtcggtagcggat
gtggtggtgtggagcacgctgttccctgtgctccgagacgaagccatccctgcagctgag
ccgctgcagagctggttccggagcatgacgttctcagaggcgtgcaggaatgctgctgac
actgtgctgctgccacggcacctgcaggaattcacagcctgcctacagaagctgcccctg
ccacgcccaccaccagacacggccccaggctgtgaggaggatgacgtatcggagcgggcg
ctgacggaggaggatatggcagcggctgtggatgcctggactcgtggtgctgccgcgctg
cccaaaccctggcggcctccaaaacctgtgttgccagtggagggcatgaggaacgtgctg
atcaccagcgccttgccctacgtcaacaacgtgccccacctgggcaacatcattggctgt
gtcctcagcgctgacgccttcgccaggtactgccgcctgcggaactggaacacgctgtac
gtgtgcggcaccgacgagtacggcacagccaccgagaccaaagcagtggaggaggggctg
acgccacgggagatctgtgataaataccacgctgtgcacgccgacatctaccgctggttc
gacatctcctttgattactttggccgcaccaccacaccgcagcagaccgtcatttctcag
gacatcttccaacgcctgcaggcccacggctttgtgctgcaggacacggtgcagcagctg
cactgtgccagctgccagcgcttcctggctgaccgctttgtggagggcatctgccccttc
tgcagctaccaggaagcgcgcggcgatcagtgcgacaaatgtggcaaactcatcaatgcc
gtggagctgaagactcctcgctgcaagctgtgcagtggcagccccacggtgcggcccacc
cagcacctcttcctcgacctccccaagctggaggagcggttgcaaccgtggctggagaac
tgctgggccacgggaaactggacagccaatgcccgctacatcacgcgctcctggatccgt
gacgggctgcggccacgctgcatcacacgggacctgcagtggggcacacctgtgcctctt
gatggcttccgggacaaggtgttctacgtgtggttcgatgctcccatcggatatctgtcc
atcactgccaactacacggagcactgggagcgctggtggaagaacccgcaacaggtggag
ctgtacaacttcatggccaaggacaacgtgcccttccacagtgttgtgttcccctgctcg
ctgctgggcaccgatgacaactacacactggtcaaccacctcattgccacagagtacctg
aactatgaggatgggaaattttccaagagccgtggcgtgggggtgtttggggacatggcc
aaggacacgggcatcgcagctgacgtgtggcgcttctacctgctgtacgttcgccctgag
ggccaggacagtgccttctcctggggtgacctcatgctgaagaacaactcggagctgctg
aacaacctgggcaacttcatcaacagagccgggatgtttgtctgcaagttctttggtagt
gcagtgccccccatggtgctgacaccggatgaccaccggctcttggctcgtgtcaccgtg
gagctgcggcagtaccaccagctgctggagagggtccgcatccgtgatgctcttcgctgc
gtcctcaatatctctcgccacggcaaccaatacatccaggtgaatgagccctggaagcgc
atcaagggtggcgaggaagacaggcagcgtgctggcactgtgaccggcgtggcagtgaac
gtggcagcgctgctggctgtgttggtgcagccctacatgccaacagtcagtgcagccatc
caagcacagctctgtgtgcccccagagtgctcagtgctcagccacatcttcacctgcaca
ctgccacctggccaccgtgttggcacggtatgggggcagcacagggggtggcgggaggaa
ggggggggggggggtgaaaccccccatccccccccccagttggaccccccctcagtgcca
ggcaagactccccctgaccccagccgcatccaggagctgacagagcaggtggccaagcag
ggcaactgcgtgcggcagctgaaggcgagtgggtcggacagagcgcgcatcgacagcgag
gtgggcaaactgctggcactgaagcgggagctggcacttgctcagaacatgagccctgat
ggccccaggggcaaagggaagaagtaa

DBGET integrated database retrieval system