KEGG   Gallus gallus (chicken): 425723
Entry
425723            CDS       T01006                                 

Gene name
HOXC9
Definition
(RefSeq) homeobox protein HoxC9
  KO
K09294  homeobox protein HoxB/C/D9
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    425723 (HOXC9)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    425723 (HOXC9)
SSDB
Motif
Pfam: Hox9_act Homeodomain CI-B14_5a HTH_23
Other DBs
NCBI-GeneID: 425723
NCBI-ProteinID: NP_001264211
CGNC: 8844
Ensembl: ENSGALG00000029439
UniProt: A0A1D5PQW8
Position
33
AA seq 262 aa
MSASGPISNYYVDSLISHENEELLASRFPTTASHPAAARPSGLVPDCADFPSCSFAPKPA
VFTTSWAPVHSQSSVGYHHPYGPQAPVGAEPRYMRTWLEPLAGAVSFPAFAPGAARPYGL
KPDAFAGRRAECGPADGRGFADYMYAAPGELRDRAAQTIPSPESEAIASSKHKEEKHELD
PNNPVANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKI
WFQNRRMKMKKMNKEKTDKEQP
NT seq 789 nt   +upstreamnt  +downstreamnt
atgtcggcttctggccccataagcaactactatgtagactccttgataagccacgaaaac
gaagagctcttggcctccaggttccccaccactgcctcccacccggctgctgccagacct
tcaggattagtcccggactgtgccgactttccttcgtgcagtttcgcccccaagccggcc
gtttttacaacctcctgggctcccgtccattcccagtcgtccgtgggctaccaccacccg
tacggcccccaggctcccgtgggggccgagcccaggtacatgcggacttggctcgagccc
ctcgccggggccgtctcgttcccggccttcgctcccggtgccgcccgcccctacggcctc
aaacccgacgcctttgccgggagacgcgcggagtgcggccccgcggacgggcgcggcttc
gcggactacatgtacgcggctcccggggagctgagagacagagcagcgcagacaattcct
tccccggagtccgaagccatcgcttccagcaaacacaaagaagaaaagcacgaattagac
cctaacaatcccgtcgcgaattggattcatgcgcgttccacgaggaagaaaagatgtccg
tacacaaagtatcagaccctggaactggaaaaagagtttttattcaatatgtacctcaca
cgggaccggaggtacgaagtagcccgagtcctaaacctcactgaacgccaagtcaaaatc
tggtttcagaacaggcgaatgaaaatgaagaaaatgaataaagagaaaaccgataaggaa
cagccatga

DBGET integrated database retrieval system