KEGG   Gallus gallus (chicken): 425791
Entry
425791            CDS       T01006                                 

Gene name
EHF
Definition
(RefSeq) ETS homologous factor
  KO
K17102  ETS homologous factor
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    425791 (EHF)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    425791 (EHF)
SSDB
Motif
Pfam: Ets SAM_PNT Acetyltransf_2
Other DBs
NCBI-GeneID: 425791
NCBI-ProteinID: NP_001264513
CGNC: 5911
Ensembl: ENSGALG00000007817
Position
5
AA seq 298 aa
MILEGAGRMSINSSSNLLHQQPSWTDGYSTCNVSSSFYGTQWHEIHPQYWTKFQVWEWLQ
HLLDTNQLDANCIPFQEFDINGEHLCSMSLQEFTQAAGTAGQLLYSNLQHLKWNGQCGSD
MYQSHNVVVKTEQTDPSLMVSWKEDNYLYDSGYGSTVELLDSKTFCRAQISMTTPSHQPP
DSSDVKKTQDHTPKSHTKKHNPRGTHLWEFIRDILLNPEKYPGLIKWEDRSEGVFRFLKS
EAVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNARGWRENEN
NT seq 897 nt   +upstreamnt  +downstreamnt
atgattttggaaggagctggcagaatgagtatcaattccagcagcaacctactccaccag
cagccttcctggacagatggatattccacgtgcaatgtgtccagcagtttctatggaacc
cagtggcatgaaatacatcctcagtactggacaaagtttcaggtctgggagtggctgcag
catctccttgataccaaccaactggatgccaactgcatacccttccaggagtttgatatc
aacggggaacatctgtgcagcatgagcctgcaggaattcactcaggcagccgggacagca
gggcagctgctttatagcaaccttcagcacctaaaatggaacggtcagtgtggaagtgac
atgtaccaatctcataatgtcgttgtgaagacagagcaaacagatccatcgttaatggtg
tcctggaaagaagacaattacctgtatgacagtggctatggtagcacagtagagctattg
gacagcaaaacgttctgtcgtgctcagatctccatgacgacaccgagtcaccagcctcct
gattcttcagatgtgaaaaaaacacaagatcataccccaaagtcccacaccaagaaacac
aaccctcgaggaactcatctctgggaatttattcgagatattcttcttaaccctgagaaa
tacccaggattaatcaagtgggaggaccggtcagaaggtgtcttcagatttttaaaatcc
gaagctgtggctcagctctgggggaagaagaagaacaacagcagcatgacttacgagaag
ctcagccgggctatgagatattattataaaagagaaatcctggagcgtgtggatggtcgc
agattagtatacaaatttggaaagaatgcccgtggctggagagaaaatgagaattaa

DBGET integrated database retrieval system