KEGG   Gallus gallus (chicken): 425805
Entry
425805            CDS       T01006                                 

Symbol
NGFR
Name
(RefSeq) tumor necrosis factor receptor superfamily member 16 precursor
  KO
K02583  tumor necrosis factor receptor superfamily member 16
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    425805 (NGFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    425805 (NGFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:gga04050]
    425805 (NGFR)
   04090 CD molecules [BR:gga04090]
    425805 (NGFR)
Cytokine receptors [BR:gga04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   425805 (NGFR)
CD molecules [BR:gga04090]
 Proteins
  425805 (NGFR)
SSDB
Motif
Pfam: TNFR_16_TM TNFR_c6 Death TPR_21
Other DBs
NCBI-GeneID: 425805
NCBI-ProteinID: NP_001139605
CGNC: 66496
Ensembl: ENSGALG00000035950
UniProt: A9UGK7
Position
27
AA seq 414 aa
MAGFVPLLLLLLPAGPTWGSKCLTKMYTTSGECCKACNLGEGVVQPCGVNQTVCEPCLDS
VTYSDTVSATEPCKPCTQCVGLHSMSAPCVESDDAVCRCAYGYFQDELSGSCKECSICEV
GFGLMFPCRDSQDTVCEECPEGTFSDEANFVDPCLPCTICEENEVMVKECTATSDAECRD
LHPRWTTHTPSLAGSDSPEPITRDPFNTEGMATTLADIVTTVMGSSQPVVSRGTADNLIP
VYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANNRPVNQTPSPEGEKLHSDSGISVDSQS
LHDQQPPNQSTQGPAPKGDGSLYASLPPSKQEEVEKLLSSSAEETWRQLAGELGYKEDLI
DCFTREESPARALLADWSAKETATLDALLVALRKIQRGDIAESLYSESTATSPV
NT seq 1245 nt   +upstreamnt  +downstreamnt
atggccgggttcgtaccgctgctgctgctcctgctgccggcgggacccacctggggctcc
aagtgcttgactaagatgtacacgacgagcggtgagtgctgcaaagcctgcaacctgggt
gagggcgtggtgcagccctgcggggtcaaccagaccgtctgcgagccctgcctggacagt
gtgacctactcggacacagtgagtgccacagaaccgtgcaagccctgcacacagtgcgtg
gggctgcacagcatgtctgcaccctgcgtggagtctgacgacgccgtgtgccgctgcgcc
tacggctacttccaggatgagctgagcgggagctgcaaggagtgcagcatctgtgaggtg
ggctttggcctcatgttcccctgccgggactcacaggacacggtctgtgaggagtgcccc
gagggcaccttctcggatgaggccaatttcgtggatccctgccttccctgcaccatctgc
gaagagaacgaggtgatggtgaaggagtgcacggccacctccgatgctgagtgcagagac
ctccacccacgctggacaacgcacaccccatccctggcgggttctgacagccccgagcca
atcaccagggaccccttcaacaccgaggggatggccaccaccctggcagacattgtcacc
accgtcatgggcagctcgcagcccgtcgtgagccgcggcaccgccgataacctcatccct
gtgtactgctctatcctggcggccgtggtggtggggctggtggcttacattgccttcaaa
aggtggaacagctgcaagcagaacaagcagggagccaacaaccgccctgtgaaccagacg
ccttccccagagggggagaagctgcacagcgacagcggcatctcggtggacagccagagc
ttgcacgaccagcagccgcccaaccagagcacgcagggaccagcaccaaagggagatggg
agcttgtacgccagcctgccgcccagcaagcaggaggaggtggagaaactgctgagcagc
tctgcggaggagacgtggcggcagctggccggggagctgggctacaaggaggacctcata
gactgcttcacacgggaggaatcgcccgcccgagcgctgctggccgactggtcggccaag
gagacggccactctcgacgccctcctggtggccctgcggaagatccaacgtggggacatc
gctgagagcctgtacagcgagtccaccgccacctcacccgtgtga

DBGET integrated database retrieval system