KEGG   Gallus gallus (chicken): 425933
Entry
425933            CDS       T01006                                 

Gene name
SNRNP25
Definition
(RefSeq) U11/U12 small nuclear ribonucleoprotein 25 kDa protein
  KO
K13153  U11/U12 small nuclear ribonucleoprotein 25 kDa protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gga03041]
    425933 (SNRNP25)
Spliceosome [BR:gga03041]
 Other splicing related proteins
  Minor spliceosome components
   Minor spliceosome specific factors
    425933 (SNRNP25)
SSDB
Motif
Pfam: Ubiquitin_4 ubiquitin SURF6
Other DBs
NCBI-GeneID: 425933
NCBI-ProteinID: XP_015150097
CGNC: 23850
Position
14
AA seq 200 aa
MPPPRPARRPPPSAAGGAGEAVAARPLLGHQNVAARRAEEQHRRILAAGPPLPAGMAEAE
EELLAHADVLELFQAALARLVQDPLLCDLPPQVTPEEIGSQVALEYGQAMTVRVCKADGE
SMPVVVVQNASVLDLKKALRRHVQLRQARRGGVQHLSWKYIWRTYHLTYAGEKLADDRKK
LREYGIRNRDEVSFIKKLRK
NT seq 603 nt   +upstreamnt  +downstreamnt
atgccgccgccccgcccagcacgtcgtccacctccttcagccgcgggtggtgcaggcgaa
gcggtggcagcgcggcccctcctcggccaccagaacgttgccgcacgccgggcagaagag
cagcatcgccggatcctcgcggcggggccgccccttccggcggggatggcggaggccgag
gaggagctgctggcgcacgccgatgtgctcgagctgttccaggcggcgctggcgcggctc
gtgcaggacccgctgctctgcgacctcccgccgcaggtgacgccggaggagatcggctct
caagtggcgctggagtacgggcaggccatgacggtgcgcgtctgcaaggcggacggcgag
agcatgcctgtggtggtggtgcagaacgcgtcggtgctggacctgaagaaggcgctgcgg
cggcacgtgcagctccggcaggcgcggcggggcggcgtgcagcacctcagctggaagtac
atctggaggacgtaccacctcacttacgccggggagaagctggcggacgacagaaagaag
ctgagagagtatggcatcaggaaccgggatgaggtcagcttcatcaagaaactccggaag
tga

DBGET integrated database retrieval system