KEGG   Gallus gallus (chicken): 425938Help
Entry
425938            CDS       T01006                                 

Gene name
PLXNB2
Definition
(RefSeq) LOW QUALITY PROTEIN: plexin-B2
  KO
K06821  plexin B
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: Plexin_cytopl Sema TIG TIG_plexin PSI RasGAP ARL2_Bind_BART
Motif
Other DBs
NCBI-GeneID: 425938
NCBI-ProteinID: XP_015130710
CGNC: 52617
Ensembl: ENSGALG00000039861
Position
1
AA seq 1845 aa AA seqDB search
MYYVEMALWIWTLSILSCFCITFSRSEELKFFQSATELNHLTVDNDTGIIYLGVVNALYQ
LTENLVVRIHVETGPRKDNKKCTPPIEENQCKEAVLTDNYNKLLLLNKENKTIVVCGSLF
KGICATRDLENITKVTHYVETSGEKSFVASNDENVSTVGLITSLDNDQVLFVGKGNGPND
NGIIISTRQLHEKDGKDIFEMYSDSAAVKSAYHSSSTQQFVTVFEDKNYVYFIFNQQEKQ
PVNNRTLIARLCKDDAHYYSYFEMDLGCKDEDGSYDHCHSAYVTTPGEELAKSMAQQRQT
TDSASDDKVLIALFSKVNKDNGSLKSAMCVFSLRHINEKMEKNRDDCYTNKNTSMFYKLF
AVENPCGQHGQNASKNFPCGSEHLPYLLGSKNGVIEKPVLQKEGMNLTAVTVTVENGHTV
AFLGTSDGKILKVFLSSTVIEYSSLTIELNKPIKNDLVLDKTQEYLYVMTTDKVHRLPVQ
QCHKYSDCEKCTQAQDPYCGWCVREGRCTKRADCEMADKENDWLWSPSGTCMTIISADPQ
NMSRRAPAKVKLTVSPLPTLSTSDKLWCTFGETSHRAQLNEGVIICDPPDMIPPTPKGQD
HVSVPLQLTFGENKIFFASHTYPFYDCEEAMNLYENQPCYSCASNRWNCQWDWKKHICEE
SSSAQDVIKQNMEEECPQFLNPNPSIIPMEYRTTVHFEGRHLAYYQDEKFMVGNSQFEFE
ASVEAADEGRFSFTTKEFSYSANETLKLKLSMRTGKVKIDSKLMVTLYNCSYGRSDCSLC
LAAHEDYKCVWCEEDGKPSKCVYEKLCRAPPTNTCPHPEITRIEPKTGPLDGGILLTIMG
SNLGIKAEDVKNITVADKECVFKEEFYSVSTRIVCQVGEMKVPKQGQIEVNINGKLGKSP
SDVQFTYQDPHPTGIRPQSGPQAGGTTLTITGMNLATGSKKDVRVLLGSQPCNVTEFGDE
IVCITGRNSKVEAVGVTMHYGGTKIVVPVHFSYSENPTVTKFKPINSFSSGGRNITVTGT
GFELIQSFSLMVHAERPEAGKLSSKTFVGNCVTRLNETTVVFSSLPVLEDPENYNITTII
LMDHYQLVVKNESHSFTYVADPTFENFTDGIKKQVNKLINAKGSNLNKAMTIDEAQAFVG
DEPCNIKTLTETDLYCEPPEVQPQPKKRQKRDMINNLPEFIVKFGLREWVLGRVEYDTRV
SDIPLNLILPLVLIPMIAIIIISIICYRRKSQQAEREYEKIKSQLEGLEESVRDRCKKEF
TDLMIEMEDQTNDVNEAGIPVLDYKTYTDRVFFLPSKDGEKDVMITGKLDIPEARRQTVE
QALNQFSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMRTLF
LELMEQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKDNAGEPLYKLFKAIKHQVE
KGPVDAVLKKAKYTLNDTGLLGDDVEYTQLTVNVYVQDGGTDSTPVKVLNCDTISQVKEK
IIDQVYRNLPCLXWPKAESVALEWRPGSTAQILSDLDLTXQRDGRWKRINTLMHYNVRDG
ATLILSKMGISQQPEDNQQDVPGERHALLEDENKVWHLVRPVDEIDESKSKRGSVKEKER
TKAITEIYLTRLLSVKGTLQQFVDDFFHSVLNSNHVVPPAVKYFFDFLDEQAEKHDIKDE
DTIHIWKTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRD
SPSNKLLYAKEISNYKKMVEDYYKGIRQMVPVSDQDMNTHLAEISRAHTDSLNTLVALHQ
LYQYTNKYYDEIINALEEDPAAQKMQLAFRLQQIAAALENKVTDL
NT seq 5538 nt NT seq  +upstreamnt  +downstreamnt
atgtattacgtagagatggctctatggatctggactctaagcattttgagctgcttttgc
atcaccttttccagaagtgaggaactgaaattttttcaaagtgccacagagctaaatcac
ctaacagtggataatgacactggcataatctatttgggagtggtaaacgctctgtatcag
cttacagaaaatctggtggtacgaatacatgtggaaacagggccaagaaaggacaacaaa
aaatgcacacctcccattgaagaaaatcaatgtaaggaggcagtactgactgacaattac
aacaaattattgttgctgaacaaggaaaataagacaattgtggtgtgtggaagccttttt
aaagggatttgtgccaccagagatctagaaaacattaccaaagttacgcattatgtggaa
actagtggagagaagtcctttgtagcaagcaacgatgagaatgtatcgacggtggggctg
atcacttccttggacaatgatcaggtgctgtttgttgggaaagggaatggaccaaatgat
aatgggataataatcagcactcggcagctccacgagaaggatgggaaagacatttttgaa
atgtattcggactcggcggctgttaagtcagcatatcattcttcaagcacacaacaattt
gtgacagtctttgaggataaaaattacgtttacttcatttttaaccagcaagagaagcag
cctgtcaataaccgcacactaattgcacgtctttgcaaagacgatgcccattattattcc
tactttgaaatggacttgggttgcaaagatgaggacggttcctatgatcactgtcattct
gcttacgtcaccaccccaggagaagagctggccaagagcatggctcagcaaagacaaact
acagattctgcctcagatgacaaagtgctcattgcactcttcagcaaagtaaacaaagat
aatggctccctaaaatctgccatgtgtgtgttttcgttgaggcacatcaatgaaaaaatg
gagaaaaaccgggatgattgctacacaaataagaataccagcatgttttacaaactcttt
gcagtagaaaacccatgtggacaacatggacagaatgcaagcaaaaatttcccctgtggc
tctgaacacttaccatacctcttgggaagtaaaaatggtgttatagagaagccagtatta
caaaaagaagggatgaatctcacggctgttacagtgactgtggagaatgggcacaccgtg
gcctttctggggacttcggatggaaaaattcttaaggtgttcctgtcatccactgtaatc
gagtacagctctctgactattgaactaaataaacccataaagaatgatctggtccttgac
aaaacccaagaatatctatatgtgatgaccacagacaaggtgcatcgccttcccgtacag
cagtgccacaagtattcagactgtgagaagtgcacgcaggctcaggacccgtactgcggc
tggtgtgtgcgggagggcaggtgcacaaagagggcagactgtgaaatggctgataaggag
aacgactggctctggagtccaagtggcacatgtatgactatcatcagtgcagaccctcaa
aacatgagtcgtagagcccctgctaaggtgaaactcacagtaagtccactgccaactttg
agcaccagtgacaaactttggtgtacctttggtgaaacaagccatcgtgctcaattaaat
gaaggagttattatctgtgacccacctgatatgattccgccaacaccgaaaggtcaagat
cacgtttcagttccattacagttaacctttggagagaacaagatattttttgcatcacat
acttaccctttttatgactgtgaagaagcaatgaatctttatgaaaaccagccatgctat
tcttgtgcaagcaatagatggaattgccagtgggactggaagaaacatatctgtgaagaa
tcttcttcagcacaggatgtgatcaaacaaaatatggaagaagaatgcccacagtttcta
aaccctaacccatcaataatacctatggagtaccgaacaacagtgcattttgagggaaga
catctagcttattatcaggatgaaaaatttatggttggaaacagccaatttgaatttgaa
gcttctgttgaggcagcagatgaaggaagattttcattcacgactaaagagttctcctat
agtgcaaatgaaaccttaaaacttaaattatccatgagaacggggaaggttaagattgac
agcaaactgatggtgactctgtacaattgctcctatggaagaagtgattgcagtttgtgt
cttgccgcccatgaagactataagtgtgtctggtgtgaagaggatggcaagccaagcaag
tgtgtgtatgagaagctgtgtcgtgctcctcccaccaacacgtgtcctcatccagaaatc
actcgcattgagccaaagactggaccactggatggtggaattcttttgaccataatggga
tctaatttgggaataaaagcagaagatgtaaaaaatataacggtggcagacaaggaatgt
gttttcaaggaggaattctactctgtttccacaaggattgtgtgtcaagttggagaaatg
aaggttcctaaacaaggtcaaattgaagttaacatcaatggaaaattaggtaaatcacca
agtgatgtgcagtttacataccaggaccctcaccctactggcataagacctcaaagtggt
ccacaagcaggtggaaccacacttaccatcactggtatgaacctggcaactggttccaag
aaggatgttcgtgttcttctcggtagccagccttgcaatgtcactgaatttggagatgag
attgtttgcattacgggacgtaatagcaaggttgaagctgttggagtcacaatgcactat
gggggaacaaaaattgttgtaccagtgcatttttcatacagtgagaatcctactgtcacc
aaattcaagcccataaatagcttcagcagtggagggagaaatattacggtaactggaact
gggtttgaactcatccagagtttctcactgatggtacatgcggagcgtccagaagcaggc
aaactgagctccaaaacgtttgttggaaactgtgttacaagacttaatgaaaccacagtg
gttttttcttcactaccagtattggaagatccagaaaactataacattaccactattatt
ctaatggatcattatcagttggttgtaaaaaatgagagccattcatttacatatgttgca
gacccgacttttgaaaatttcacagatggcatcaaaaagcaagtcaacaaacttataaat
gcaaagggcagtaacctgaacaaagccatgacgatagatgaggcccaggcttttgtaggt
gatgagccatgcaacataaaaacactgaccgaaacagacttatattgtgagccacctgaa
gtacagccacaaccaaagaaaaggcagaagagggatatgatcaataaccttccagaattc
attgtgaagtttggactccgtgaatgggtccttggaagggtggaatatgatacacgtgtg
agtgacatccccctgaatcttattttgccactggtacttattcctatgatagcaatcatc
atcatttctatcatctgttacagacggaagagccagcaagcagaacgagagtatgaaaaa
attaaatcacaacttgaaggcctggaggagagtgtcagagaccggtgcaagaaggaattc
acagatctaatgatagagatggaggatcagacaaatgatgtaaacgaagctggaatccca
gtactggactacaaaacgtacacagacagagtcttcttcttgccttccaaagatggggag
aaggacgtgatgattacagggaagctggacattccagaggctcggcggcagactgtggag
caggctctgaaccagttctccaacctcctcaatagcaaatcatttctcattaattttatt
cacactctggaaaaccaaagggagttctctgctcgagctaaagtttattttgcctctcta
ctgacggtcgctttacatggaaaactagaatactatactgacatcatgaggactctgttc
ttagaactgatggagcagtacgtggtggccaaaaacccaaagttgatgctaagaagatct
gaaacagttgttgagagaatgttgtctaactggatgtctatttgtttatatcagtacctc
aaggacaatgctggggagcctctttacaaattgttcaaagccatcaaacaccaggtagaa
aaaggtccagtggatgctgtactgaagaaagccaagtatacactgaatgatacaggctta
ctaggagatgatgtagagtatacacagttgacagtaaatgtgtatgtacaagatggagga
actgattctacacctgtgaaagtgctgaactgtgatactatatcacaagtaaaggaaaag
ataatagaccaagtctatcgaaatctgccgtgtctcnagtggccaaaagctgagagtgta
gctcttgagtggcgtccaggttctactgcacagatcctctcagacttggatttaactncc
caaagagatggcagatggaaacgtatcaacacactgatgcattataatgtccgagatggt
gccacactcatcttatcaaaaatgggaatttcccagcagccagaggataatcagcaagat
gtcccaggggaaaggcacgcgcttctggaagatgaaaataaggtctggcacctagtccgg
cccgtagatgaaattgatgaaagcaaatcgaagagaggcagtgtgaaagaaaaagaaaga
accaaagctattacagaaatctacctgacaagacttctgtctgtgaagggaacacttcag
cagtttgtagatgacttctttcatagtgtgctcaactcaaaccatgtagtgccaccagct
gtgaaatacttctttgactttcttgatgagcaagcagaaaaacatgacatcaaggatgaa
gataccattcacatctggaaaacaaacagcttgcctcttagattctgggtaaacatactg
aaaaatccccacttcatctttgatgttcacgttcatgaagtagtggatgcttccttgtca
gtcattgcacagactttcatggatgcttgcacaagaacagagcacaaattaagcagagat
tctccaagtaataaattactttatgcgaaagagatctctaattataagaaaatggtggaa
gattactacaaaggtattcgtcagatggtaccagttagcgaccaagatatgaatacccat
ctagcagaaatctctagggcacataccgattccttaaacacgcttgtggctctacaccaa
ctctaccagtacactaacaaatactatgatgagattataaatgcacttgaagaggatcca
gctgcacaaaaaatgcagctcgccttccgtttacagcaaatagcagctgcgttagagaat
aaagtgactgacctttga

DBGET integrated database retrieval system