KEGG   Gallus gallus (chicken): 425978
Entry
425978            CDS       T01006                                 
Symbol
SH2D2A
Name
(RefSeq) SH2 domain-containing protein 2A
  KO
K08273  SH2 domain-containing protein 2A
Organism
gga  Gallus gallus (chicken)
Pathway
gga04370  VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    425978 (SH2D2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:gga04990]
    425978 (SH2D2A)
Domain-containing proteins not elsewhere classified [BR:gga04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   425978 (SH2D2A)
SSDB
Motif
Pfam: SH2
Other DBs
NCBI-GeneID: 425978
NCBI-ProteinID: XP_015153916
CGNC: 13721
Position
25:2602233..2607911
AA seq 443 aa
MDDAQPLFITFKGIAEDKERSIQPGHGTTPLQPRSVEQCDARGRGGQGAAECPQPQLPVA
PCPVLQGCSQPGEVAASLRARTKLWFEQTQVHRLGATGNLPAWFHGFISRRDTEQMLQDE
PLGCFLVRFSESTVGFVLSYRGRERCRHFVLDQLPNGHYVILGEHSAHPELAELLQHYAR
IPIPPYGELLTVPRGQDKACGVMCTPDSSSPSCKASANHPAYSTTAKRAPGDGQAAESSP
EQAPSIPLPLPAKVSSSVATQGPRSPAGSEGAEANSPSTQTHHEAIPVEMLDAKYQQLVR
FHTYAEPHEGTALPVEPIPFYAMGWGSSPNPEANIYAEVATARQEPPPRGSTRGPGSMLA
PTFPRRQLSRSLSSQGFHRRQLPATPTAGTMQRTRPRPAPEIPPVPMNSALEFDDPVYSP
RMSSTKQAAAPENIYEQVPRGRP
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggatgacgcccagcccctcttcatcaccttcaaaggcatcgctgaagacaaggaacgc
agcatccagccaggacatggcacgaccccgctgcagccccggagtgtggagcagtgtgat
gcacggggcagggggggacagggagcagctgagtgcccccagccccagctgcccgtcgct
ccctgccccgtgctgcagggctgctcgcagcccggggaggttgcagcatccctgcgggca
cgcaccaagctgtggtttgagcagacgcaagtgcatcggctgggagccacgggcaacctg
ccagcctggttccacggcttcatcagtcgcagggacacggagcagatgctgcaggatgag
ccgctgggctgcttcctggtgcgcttcagcgagagcacagtgggttttgtgctgtcctac
aggggcagagagcgctgccgacactttgtgctggaccagctgcccaatgggcactacgtg
atcctaggtgagcacagcgcccaccctgaactggccgagctgctgcagcactacgcccgc
attcccatcccaccctatggtgagctgctgaccgtgccacggggacaggacaaggcctgt
ggagtgatgtgcaccccagatagcagctccccatcctgcaaggcatcagcaaaccaccca
gcatacagcaccacagccaagcgggcgccaggagatgggcaggcagcagagagtagccct
gagcaggcccccagcatccccctgccactccctgccaaggtcagctcttcagtggccacc
cagggaccacgcagccctgctggcagcgaaggagcagaagccaacagcccctccacacag
acacaccatgaagccatccctgttgagatgcttgatgccaagtaccagcagctcgtgcgc
ttccacacttacgcagagccccatgagggcacagccctgcctgtggagcccattcccttc
tatgccatgggctggggctccagccccaaccctgaggctaacatctatgcagaggtggcc
acagcccggcaggagccaccgccccgcggcagcacacggggccctggatccatgctggcc
cccacatttccacgccgacagctgtcccgcagcctctcaagccagggcttccacagaagg
cagctgccagcgactcccactgcaggcaccatgcagagaacacgaccccggccggcccca
gagattcccccggtcccaatgaactcagcactggagtttgatgaccccgtgtacagcccg
aggatgagcagcaccaagcaagccgcagccccagagaacatttacgagcaggttcctaga
ggccgcccctaa

DBGET integrated database retrieval system