KEGG   Gallus gallus (chicken): 426047
Entry
426047            CDS       T01006                                 

Gene name
SAFB
Definition
(RefSeq) scaffold attachment factor B1 isoform X2
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: RRM_1 SAP RRM_5
Other DBs
NCBI-GeneID: 426047
NCBI-ProteinID: XP_015155209
CGNC: 52657
Ensembl: ENSGALG00000013365
Position
28
AA seq 894 aa
MAESQSAAGLGELTSPGGAVTLGSEPETRRLSELRVIDLRAELKRRNLDTGGNKSVLMER
LRKAIEDEGGDPDEIPMASELTNKRLSKRMSKGRKSEEEGVEDNGLEENSRDGQEDIEAS
LDTLQDIDMMDISVLDEAEIDNSSAVDCGEDYSPDNILDSLSDNKDNVDAEMKELPDQLT
ENEKMEKLHLEPENEKILDILGETCKSELLNEETSEAEQPHAQEASNVVPGKRLAEEEDA
LGAAQSEEDALDLDSKSAQAMARKEAKRLVVAKGETSEQTIEEEKLDSDSVGVESVSDQS
SKRCQGLEASSGETAERGAGPEGKDSKEDGKKAEDKANSEESPATKESSASEGGDQKKSP
VEEDRDTKLISKDEKGRTAGGSGRNFWVSGLASTTRATDLKNLFSKYGKVVGAKVVTNAR
SPGARCYGFVTMSTAEEATKCITHLHKTELHGKIISVEKAKNEPAGKKPTEKKENESKKE
TASERPSSSKRDEKCDQKDDSKKAEDKDEKERKEKDEQKSASSDQPKSSKSGSKGTERTV
VMDKSKGEPVISVKTSTTSKDRSVKSQDRKSESRERQGIVPFDKIKAQRKMREAEQRRTR
ERRERQQHLQTIREREERERLEIARERLEIERQRLERERMERERLERERMHIEHERRREQ
DRIQREREELRRQHEQLRYEQERRSAMRRPYDIDGRRDDPYWPEAKRMAMNDRYHSDFGR
QDRFHDFDHRDRGRYQDHSLDRRDGSRTMMGDRDGQHYPDERHGGPERHSRDSRESWGSY
GSDRRMSESRGIPPPSRDGRDWGDHGRKFEGHQERSWQSSVDGGMMGRDHERWQGGGRGR
PGHVMHRGGMSGRGGFMQGGNQSQMMHGGGMQGEGFAGQERASRPNDPRFNRRY
NT seq 2685 nt   +upstreamnt  +downstreamnt
atggcggagagtcaatcagcggccgggctgggggagctgacatcccctgggggggccgta
acgctcggctcggaacccgaaacccggcggctgagcgagctgcgggtcatcgacctgcgg
gcggagctgaagcgccgcaacctggacacgggcggcaacaagagcgtcctgatggagcgg
ctgaggaaggctatcgaggacgaaggaggagatccagatgagattcccatggcttcagaa
ctgaccaacaagaggctgtcaaaaagaatgagcaaaggaagaaaatcagaagaggaagga
gtggaagacaatgggctagaagaaaactccagagacgggcaggaggatattgaagcaagc
ctggataccttacaagacatcgacatgatggatattagtgtgttagatgaagctgaaata
gacaacagcagtgctgtagactgtggagaagactatagtcctgataacattctggattcc
ctgtctgataataaagacaatgttgatgcagaaatgaaagaacttccagatcagctaaca
gaaaatgagaaaatggagaaactacacttggagccagaaaatgagaaaatactcgacatt
ttgggggaaacttgtaaatctgagctccttaacgaagaaacctccgaagcggagcagccc
catgcacaggaagcaagtaacgtggtgccaggcaagaggctagcagaggaagaggacgct
cttggtgccgctcagtcggaggaagatgctttagatttggacagcaaatcggcacaagct
atggcaaggaaggaggcaaagcgtttagttgtagcaaaaggggagacaagtgaacagaca
atagaggaagagaagctggactctgactctgtaggagtagagagcgtaagcgatcagagt
agcaagcgctgccaaggcctggaagcctctagtggggaaacagcggagagaggcgcaggt
ccggaaggcaaagatagcaaagaagatggcaagaaagcagaagacaaagctaattcagag
gaatcccccgctactaaagagtcctcagccagtgagggcggtgatcagaaaaagagccct
gtggaggaggacagagatacaaagctgatctcaaaagacgagaaaggtcgcactgctggc
ggttctgggagaaacttttgggtgagtggacttgcttccaccaccagagctacagactta
aagaatctgtttagcaaatatgggaaggtggttggtgcaaaagtggtcaccaatgcccgc
agccccggtgcacgctgttatggctttgtcaccatgtctacagctgaggaagccacgaag
tgcattactcacctccacaaaacggagttacacgggaagataatttctgtggaaaaagca
aaaaacgaacctgctgggaagaaaccaactgaaaaaaaggagaatgagtcaaagaaagaa
acagccagcgagaggcctagcagtagtaaaagggatgagaaatgtgaccaaaaagacgat
tccaaaaaggccgaagacaaagatgaaaaagaaaggaaagagaaggatgaacagaaatct
gcttcatcggatcagcctaaatcttccaagtcagggagtaaaggaacagagagaacggtg
gtaatggataaatccaaaggagaacctgttatcagtgtgaaaacatcaactacatcaaaa
gacagaagtgttaagagccaggatcgcaaatcggagagcagggagaggcaaggcattgtg
cccttcgacaaaatcaaagctcagaggaaaatgagggaggccgagcaacgccgcacccgt
gagcggcgggagaggcagcagcacctgcagaccatccgggaacgcgaggaaagggagagg
cttgagattgctcgtgagagactggaaattgaaaggcaacggcttgagagagagcggatg
gagagagagagactggagagagagcggatgcacatagagcatgaaaggaggagggaacaa
gatcgcatccagcgagaaagggaggagctgcgacggcagcacgagcagctgcgctacgaa
caggaacgccgctctgccatgagaaggccgtatgacattgacggcaggagggatgatccg
tactggcctgaagcgaagcggatggcgatgaacgataggtaccattctgacttcggccgc
caggatcgcttccacgacttcgaccacagggatcgtggccgataccaagaccactcatta
gacaggagggatggatcgaggacaatgatgggagatcgcgatggacaacattacccagac
gagcgccatggagggcccgagcgccactcacgggactcccgggagagctggggcagctac
ggctccgacaggaggatgagtgagagcagagggatccccccgccctcacgggatggccgt
gactggggagaccacgggaggaaatttgaagggcaccaggagcgttcgtggcagagcagt
gtggacggagggatgatgggacgggatcacgagagatggcaaggtggaggtagagggaga
cctggccacgtgatgcaccgtggaggcatgtcagggcgaggagggttcatgcaaggaggg
aaccaaagccagatgatgcacggaggagggatgcaaggggagggatttgctggccaggag
agagcaagcagacccaacgatccccggttcaaccgtcgctactga

DBGET integrated database retrieval system