KEGG   Gallus gallus (chicken): 426068
Entry
426068            CDS       T01006                                 

Gene name
CELSR1
Definition
(RefSeq) LOW QUALITY PROTEIN: cadherin EGF LAG seven-pass G-type receptor 1
  KO
K04600  cadherin EGF LAG seven-pass G-type receptor 1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    426068 (CELSR1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    426068 (CELSR1)
   04515 Cell adhesion molecules [BR:gga04515]
    426068 (CELSR1)
Peptidases and inhibitors [BR:gga01002]
 Mixed peptidases
  Family P2
   426068 (CELSR1)
G protein-coupled receptors [BR:gga04030]
 Adhesion receptor family
  Cadherin EGF LAG (CELSR)
   426068 (CELSR1)
Cell adhesion molecules [BR:gga04515]
 Cadherins
  Major cadherins
   426068 (CELSR1)
SSDB
Motif
Pfam: Cadherin GAIN 7tm_2 Laminin_G_2 Laminin_G_1 Cadherin_3 EGF GPS Laminin_EGF hEGF Dicty_CAR RET_CLD1 Cadherin_4
Other DBs
NCBI-GeneID: 426068
NCBI-ProteinID: XP_423746
CGNC: 10080
Ensembl: ENSGALG00000043355
Position
1
AA seq 3339 aa
MNNAEQQQKVHSKQLHTMKNNGKILRAKGMTSSSGCFVVQVMQGSHLLFLVTMALLDAVE
LSFTFPLTDVLAIIPPFFPLETTPFRAEGSRRDRRFSHPAGSAAAPQPQDGPTAAPSRRR
VPQRFPQPPPGDTAPAGTGTASGGGKRSARTHGVIAAAILKRGLRLRFSPQTVTSQRVRN
ALRPPQNELKLSRPFAYPLLCAARSGRRATTNPRRQVTAHGESRSAPSEPRSHLPKRLPP
TEPAAFPALPSGGRTDGGTEAESPAGRARPGPAPTAATAREGPGGAAGKPRPGQRPPRSA
EPAVSGAGRHNGTGRDAAAAPCGEHCGLEEQQVYANRPPGSSGRRRRRRRGAILNSLQSL
RWKSWSAPARCPRTGPGLPRSAGRSAAGEAADGCGRAGGPAGGWIVRQRAARGRCLLSPG
DAAAVRRRRRLRVLGRAALRPGSRGRRGVSAAPRRPAPPPAPGRRAAPRSRRAAGAAARR
APEGGGGRAAPRSARGAPRAPVRRAEPAARPAAGGPRAPRSGLRLGGGDGRRAARRARSP
NSPPQFQLPSYQVSIPENEPAGTAVIVLRAQDPDEGEAGRLAYSMEALFDERSNDYFSID
PQTGGVVTARSLDRETKDTHVLKVTASDHGSPRRRSATTYLTVTVSDTNDHEPVFEQPEY
RESIRENLEVGYEVLTIRATDGDAPANANMLYRLLEPGAGDGVFEIDPRSGVVRTRAPVD
REEVSEYHLVVEANDQGKDPGPRSATAMVHITVEDENDNYPQFSEKRYLVQVQEDAPVNS
QILQVQATDRDRGSNAQVHYSIVSGNLKGQFYIHSFSGAIDLINPLDYETIREYTLRIKA
QDGGRPPLINSSGMVSVQVVDVNDNAPIFVSTPFQATVLENVPLGYSVLHIQAVDADSGE
NARLEYKLIEMAPPAGVAPASGDSGFPFQINNSTGWITVAAELDRETVENYXLGVEARDH
GVPVMTSSASVSITVLDVNDNNPTFTEKVYHLRLNEDAAVGSSVLTLTAVDRDVNSVVTY
QITSGNTRNRFAITSQSGGGLITLALPLDYKQERQYVLTVTASDGTRFDTVQVFINVTDA
NTHRPVFQSSHYTVSVSEDKPXGTSIVTISATDEDTGENARITYILDDNIPQFRIDPDTG
TITTLMELDYEDQASYTLAITAHDNGIPQKSDTTYVEILILDANDNAPRFLRDRYQGSVF
EDVPLSTSVLQLSATDRDSGLNGRLLYTFQGGDDGDGDFYIEPTSGVIRTLRKLDRENVA
VYSLRAFAVDRGSPPLKASVDIQVTVLDINDNPPVFEKDEFDIFVEENSPVGSIVARISA
ADPDEGTNAQIMYQIVEGNIPEVFQLDLLNGDLTALMDLDYESRTEYVIVVQATSAPLVS
RATVHIRLLDQNDNPPVLQDFQILFNNYVTNKSNSFPSGVIGKIPAHDPDVSDSLAYTFV
QGNELNLLLLDSATGXLKLSRDLDNNRPLEALMKVSVSDGVHSVTAVCTLRVTIITDDML
TNSITVRLENMSQERFLSPLLSLFVEGVATVLSTTKDGIFVFNIQNDTDVSSNILNVTFS
ALLPGGIRNKFFPSEDLQEQIYLNRTLLTTISTQRVLPFDDNICLREPCENYMKCVSVLK
FDSSAPFISSNTVLFRPIHPINGLRCRCPPGFTGDYCETEIDLCYSNPCGSNGLCRSREG
GYTCECYEDYTGEYCEVNARSGRCAPGVCKNGGTCINLLIGGFKCECPPGEYERPYCEMT
TRSFPPQSFITFKGLRQRFHFTVSLMFATRERNALLLYNGRFNEKHDFIALEIIEEQIQL
TFSAGETTTTVAPFVPGGVSDGQWHSVQVQYYNKPNIGRLGIPHGPSGEKVAVVTVDDCD
TAVAVRFGSLIGNYTCAAQGTQTGSKKSLDLTGPLLLGGVPNLPEDFPVHNRQFIGCMRN
LSIDSKPIDMASFIANNGTLPGCAAQRNYCEANWCQNGGTCVNKWSTYICECPVQYGGKN
CEQVMPSPQRFSGESIIIWSELDITISVPWYIGLMFRTRKVNGMLMQANAGTASKINIQI
LNNYVQFEVYSGMTQVASLKMTQSRVSDGEWHHLLIELKSAKDGKDIKYLAVMSLDYGMY
QSTVQIGNQLPGLKMKSIIVGGVSGDQVSVQQGFYGCMQGVRMGETSTNIATLNMKQAIK
INVKEGCEVDNPCDSNPCPQHSYCSDDWDSYSCVCDPGYFGRDCVDVCNLNPCEHVSTCV
HKPSSSHGYTCECGQSYYGQYCESKIDLPCPRGWWGNPICGPCNCETSKGFDPDCNKTNG
ECHCKANYYRPQSSDTCYPCDCFPSGSHTRSCDMETGQCPCKPGVIGRQCNRCDNPFAEV
TARGCEVIYNGCPKAFEAGIWWPQTKFGQPAAVPCPKGSVGNAVRHCNIEKGWLPPELFN
CTTNTFVDLKVMNEKLHRNETILDGDKTIQIVRVLQNATKYTHSMYGNDVRTAYQMMIRV
LRYESQQQGFDLAATRDVEFNENIIKVGSALLDPNNKEQWEQIQRTEGGTAHLLRHYEDY
FNNVAQNMKKTYMRPFVIVAANMIIAVDIFDKSNFTGARIPRFHEIKEDYPKDLESSVIF
PDTLFRPSDRKAVPTMRPSNQKLSSKVNSDARSPESMFTKRRKRHPDDSTHHTVAMVIIY
RSLGHLLPENYDPDRRSLRLPNRPIINTPVVSTAVHSDGDLPPNLVEKPIIVEYTMLETE
ERTKPVCVFWNHSIMIGGTGAWSSRGCELFSRNQSHIACQCNHLTSFAVLMDISKRENGE
VLPLKIVTYTTVSISLVALLITFILLVLIRTLRSNLHSIHKNLVAALFFSELVFLIGINQ
TENPFVCTVIAILLHYFYMSTFAWMFVEQLHIYRMLTEVRNINFGHMRFYYVVGWGIPAI
ITGLAVGLDPQGYGNPDFCWLSVHDTLIWSFAGPIVIVVVINTVIFILAMKASCRRRQXF
IEKTGVISVLRTAFLLLLLISATWLLGLMAVNSDVMTFHYLFAIFSCLQGLFIFFFHCVF
NKEVRKHLKNTLTGKKPLPDDSTATRATLLTRSLNCNNTYIEEPNMYRTTIGESTVSLES
TVRSAKSHNSYLAYILRDDAAHKLSGSSSQARAGQTEADSSIFHRNPSKSNEHDSDSDSE
LSLDEHSSSYASSHSSDSEEDGLEPEKKWNTSTAKNNERGPLHSTPKVDTLPNHVKPYWP
TECITASDSEDPSGKQKLKVETKVNVELHRENQVNHSNEAPQDKENDGQQKENRPLSHQN
NQQPEQRKGILKNKVTYPPPLIDKNMKNRLREKLSDYNQTTISSRTTSLGTNDGVRSPSD
SGVTVKNARREQSRDQLNGMAMNVHVGTGHAETSDSEKL
NT seq 10020 nt   +upstreamnt  +downstreamnt
atgaataacgctgagcagcagcagaaagttcacagcaagcagctgcacaccatgaaaaac
aacggcaagatcctccgtgccaaaggaatgacctccagcagtggctgctttgtggttcag
gtgatgcagggaagtcacttgttatttctggtcaccatggcattgctggatgctgtggag
ctcagctttactttccccctgacggacgtattggcgataatcccacctttttttcccctt
gaaacgacgccgttccgggccgaaggcagccgaagggaccgccgtttctcgcaccctgca
gggagcgcagcggctccgcagcctcaggacggcccgacggccgccccctcccggcggcgc
gtcccgcagcgcttcccgcagcccccgccaggggacactgcgcccgcggggacgggcacg
gcgagcggcggcggaaagcgctcagcgcgaacgcacggagtcatcgccgccgcgatattg
aaacgcgggcttcggctccgcttctcccctcagaccgtaacttcgcagagagttcgcaac
gctttgcggccgccccaaaacgagctcaaactcagccgtccttttgcctacccgctgctc
tgcgcggcccgcagcggtcggcgagctacgacgaatccgagacgacaggtgactgcgcac
ggggaaagccgcagcgctccgtcggagccgcgctcccacctcccgaagcggctccccccg
acggagcccgccgccttccccgcgcttccgagcggcggacggacggacggagggacggag
gcagagagccccgcggggcgcgcccggcccggcccggcccccaccgccgccaccgcccgg
gaggggccgggaggggctgccgggaaaccccgccccgggcagcgcccgccgcgcagcgcg
gagcccgcagtgagcggagcggggcggcacaacgggacgggacgggacgcggcggctgca
ccgtgcggggaacactgcggcctagaggagcagcaggtttatgctaatcgccctcccggg
agcagcggtaggaggaggaggaggaggagaggagccattttgaactcacttcaaagttta
aggtggaaaagttggagcgctcccgcccgctgcccgcggacggggccggggctcccgcgg
agcgcggggcgcagcgcggccggggaggcggctgatggctgcgggcgggcgggcggcccg
gcgggtggatggattgtgcggcagcgcgcagcccgcggtcgctgcctcctgagccccgga
gatgccgcggctgtccgccgccgccgccgcctgcgtgtcctgggccgcgctgctctgcgc
cctggctcacgcggacggcgcggagtctcggccgccccgcgccgccccgctcctccacct
gcccccgggcgccgcgccgcgccgcggagccgccgagccgccggcgctgccgcccgccgg
gcgcctgagggcggcgggggccgcgccgcgccgcgctccgcccgcggagccccgcgggcc
ccggtgcggagggctgagcccgcggcgcggccggcggcgggcggcccccgagccccgcgg
agcggactgcgcttgggcggaggggacgggcggagggcggcgcggcgggcgcggagcccc
aacagccccccgcagttccagctgcccagctaccaggtgtccatccccgagaacgagccg
gccggcacggcggtgatcgtgctgcgcgcgcaggaccccgacgagggggaggcgggccgg
ctggcgtactccatggaagcgctcttcgacgagcgctccaacgactacttctctatcgac
ccccagacgggcggcgtggtcaccgcccgcagcctcgacagggagacgaaggacacccac
gtgctgaaggtgaccgcctccgaccacggctccccgcgccgccgctcggccaccacctac
ctgacggtgacggtcagcgacaccaacgaccacgagccggtgttcgagcagcccgagtac
cgggagagcatccgcgagaacctggaggtgggctacgaggtgctgaccatccgcgccacc
gacggcgacgccccggccaacgccaacatgctgtaccgcctgctggagccgggcgccggg
gacggggtcttcgagatcgacccgcgctccggggtggtgaggacccgcgccccggtggac
cgcgaggaggtctccgagtatcacctggtggtggaagccaacgaccagggcaaggatccc
gggccacgcagtgccacggccatggtgcacatcaccgtcgaggacgagaacgacaactac
cctcagttcagcgagaagcgctacctggtgcaggtgcaggaggacgccccggtgaacagc
cagatcctgcaggtgcaagccacggatcgggaccggggcagcaatgcccaggtgcactac
agcatcgtgagcggcaacctgaaaggtcagttctacatccactccttctccggtgccatc
gatctgatcaaccctctcgactatgagactattcgggagtacacgctccgcatcaaagcc
caggatgggggcaggcctcccttaatcaactccagcggcatggtgtcggtgcaggttgtg
gacgtcaatgacaatgcccccatcttcgtcagcactccctttcaggccacggtgctggag
aacgttcctctgggctactcggtgctgcacatccaggctgtggacgctgactctggggag
aacgcgcgcctggaatacaagcttattgagatggcgccgccggctggggttgcccctgca
tcgggggactccgggtttccctttcaaatcaacaacagcacagggtggatcacggtggct
gcagagctggaccgagaaactgtggagaactacncacttggcgtggaggccagggaccat
ggtgtgccggtgatgacctcctcagccagcgtgtccatcactgtcctggatgtgaatgac
aacaaccccaccttcaccgagaaggtctatcatctccggctgaatgaggatgcagctgtg
ggcagcagtgtcctcaccctgactgctgtggacagggacgtgaacagcgtagtgacctac
cagatcaccagtggcaacaccaggaaccgctttgccatcaccagccagagcggaggggga
ctgatcacgctggccttgcctctggattacaagcaggagaggcagtatgtgctcactgtc
actgcctctgatggcactcgctttgacaccgtccaggtcttcatcaacgtcacagatgcc
aacacacaccgcccagtcttccagagctcgcactacacggtgagcgtcagcgaggacaag
ccanttggcacctctattgtcaccatcagcgccactgatgaagacacgggggagaatgca
agaatcacttacattttggatgacaacatccctcagttccgcattgaccccgacaccggc
accatcaccaccctgatggagctggactacgaggaccaggcgtcctacacattggccatc
acagcccatgacaacggcatcccgcagaaatcagacaccacctacgtggagatcctcatc
ctggatgccaatgacaacgccccccgcttcctgcgcgaccgctaccagggctcagttttt
gaggacgtgccgctctccaccagcgtcctgcagctttctgccaccgaccgcgactcgggc
ctcaatggccgcttgctctacacgttccaaggtggggatgatggagatggagacttctat
atcgagcccacctctggagtgatacgcacgctgcgcaagctggaccgtgagaatgtggcc
gtctacagcctgcgggcctttgctgtagacaggggcagcccgccgctgaaggcctctgtg
gatatccaggtgactgtgctggacatcaatgacaatccccctgtctttgagaaggatgag
tttgatatctttgtggaggagaacagccctgtgggctctatcgtggcccgaatcagcgcg
gccgaccctgacgagggaaccaacgcgcagatcatgtaccagatagtggagggcaacatc
cctgaggtcttccagctggacttgttgaatggggacctcacggccctgatggacctggat
tacgagagccgcacggagtatgtgatagtggtgcaggccacctcggccccactggtgagc
cgggcgaccgtgcacatccgcctgttggatcagaacgacaacccacccgtcctgcaggac
ttccagatcctcttcaacaactacgtgaccaacaagtccaacagcttcccctccggtgtg
atcggcaagatccctgcgcacgaccctgatgtgtcagacagcctggcctacacctttgtg
caaggcaatgagttaaacttgctcctcttggactccgccactgggngactgaagctcagc
cgagacctggacaacaaccggcccctggaagccctcatgaaagtgtcggtttcagacggc
gtccacagcgttacggctgtttgcaccctgcgtgtcaccatcatcacagatgacatgctg
accaacagcatcacggtgcggctggagaacatgtcccaggagaggttcctttctcctctc
ctctccctgtttgtcgagggggtggcaacagtgctctccaccaccaaggacggcatcttc
gttttcaacatccaaaacgacacagatgtcagctccaatatcctgaatgtgaccttctca
gctctgctccctggtggcattcgcaacaagttcttcccctccgaggacctgcaggagcag
atctacctcaataggacgctgctgaccacgatctccacacagagggtgctgcctttcgac
gacaacatctgcttgcgcgagccctgcgagaactacatgaagtgcgtctccgtcctcaag
tttgacagctcggccccattcatcagctccaacactgtcctcttccgccccatccacccc
atcaatggcctgcggtgccgctgcccacctggcttcaccggcgattactgcgagaccgag
atcgacctgtgctactccaacccgtgtggcagcaatgggctgtgccgcagccgagaaggg
ggctacacttgcgagtgctacgaggactacactggagagtactgcgaggtgaacgcccgc
tccggccgctgtgccccaggtgtgtgtaagaatggagggacctgcatcaatctgctgatc
gggggattcaagtgcgagtgcccaccaggagaatacgagcggccctactgcgagatgacc
accaggagcttccccccacagtccttcatcaccttcaaggggctgcggcagcgcttccac
ttcaccgtctcgctcatgttcgcaaccagggagaggaacgctctcctcctctacaacggg
cggttcaatgagaagcatgacttcattgccttggagatcattgaggagcagatccagctc
acgttctctgcaggagagacaaccacgacggtggcaccatttgttcctggaggagtcagt
gacgggcaatggcattcagtccaggtgcagtactacaataagcccaacattgggcgatta
ggaattccccatgggccttcgggggagaaggtggcagtggtgaccgtggatgactgtgac
acagcagtggccgtacgcttcggaagcctcattggaaactacacctgtgctgcccagggg
actcagactggctcaaagaaatcgctggacctgactggccctctgctgctcggcggcgtc
ccaaacttgccagaagatttcccagtgcacaacaggcagttcatcggctgcatgaggaac
ctctccattgacagcaagccaattgacatggctagtttcattgccaataatggcacgctg
ccaggctgtgcagcacagaggaactattgtgaagccaactggtgccagaacggaggcacg
tgtgtcaacaagtggagcacctacatctgcgagtgccccgtgcagtatggagggaagaac
tgcgagcaagtaatgccttctccccagcgtttcagtggtgagagcattatcatttggagt
gaacttgatattaccatctctgtgccatggtacattgggctgatgttcagaacacggaaa
gtcaatggaatgctgatgcaagcaaatgcaggaactgcatccaagatcaacattcagata
cttaacaactacgtgcagtttgaagtatacagtggcatgacccaggttgccagtttgaag
atgacccaatcacgagtcagtgatggggaatggcatcatttattgatagaactgaagagt
gctaaagatggaaaagatatcaagtacctggctgtcatgtctttggactatgggatgtac
cagagcactgtgcagattggaaatcaactacctggactgaaaatgaaaagcatcattgtg
ggaggtgtctctggagaccaagtctccgttcagcagggattttacggctgtatgcaggga
gtaagaatgggagagacatctacaaatatagctactctgaacatgaaacaagctatcaag
atcaacgtgaaggagggttgtgaagtggataacccttgtgactccaacccatgtcctcag
cacagctactgcagcgatgactgggacagctactcctgtgtgtgcgacccagggtacttt
ggaagagactgtgttgatgtatgtaacctgaacccatgtgagcatgtctccacgtgtgtg
cataaacccagctcatcccatggatacacctgcgaatgtgggcagagctactatgggcag
tactgtgagagcaagattgacttgccttgtcccagaggttggtggggaaatcccatctgt
ggtccatgtaattgcgagactagcaaagggtttgatccagactgcaataagaccaatggg
gaatgccactgcaaggccaattactaccggccgcagagcagtgacacctgctacccctgc
gactgcttcccctccggctcccacacgcgctcctgcgacatggagacgggacagtgtccc
tgcaagcccggtgtcatcgggcggcagtgcaaccgctgcgacaaccccttcgctgaggtc
accgccaggggctgcgaagtaatttataacgggtgtcccaaagctttcgaggctggcatt
tggtggccgcagaccaagtttggccagccagctgctgtgccatgtccaaagggatctgtg
ggaaatgcagttcgccattgtaacattgagaagggctggctgcctcccgagcttttcaac
tgtaccaccaacacttttgtggatctaaaagtcatgaatgagaagttacaccgcaatgag
accatactggatggagacaagaccatacagattgtgagggtgctacaaaacgccaccaaa
tacacacacagcatgtatggcaatgatgtgaggacagcttaccagatgatgatccgggtc
ctacggtatgaaagccagcagcaagggtttgacctggcagcaacgagagacgtggagttc
aatgagaatattatcaaagtgggtagtgccctgctggatcccaacaacaaggagcagtgg
gaacagattcagcgaacggagggtggcacagctcatctcctaaggcactacgaggattat
ttcaacaacgtggcccagaacatgaagaaaacctacatgagaccttttgtcattgttgct
gctaacatgattattgccgttgacatctttgacaagtctaattttacgggagctagaata
ccacgatttcatgagattaaggaggattatccgaaagatctggagtcatctgttatcttc
ccagatactctgttcagaccttcagacaggaaagcagtgcctacgatgaggccttcaaat
caaaaattatcctctaaggtgaacagtgatgcacgaagccctgagagtatgttcacaaag
agaagaaagcggcaccccgatgactctacccatcatactgttgccatggtcattatatac
cggtccctaggacatctcctgcctgaaaactatgatcctgaccgaagaagcctaaggtta
ccaaatcgcccaattattaatacacctgtggtgagcacagccgttcacagtgacggggat
cttcctcccaatctggtggaaaagcccatcatagtggagtataccatgctggaaacagag
gagagaacaaagcctgtctgtgtcttctggaatcactccatcatgattggcggaacaggt
gcctggtcttccagagggtgtgagctgttttccagaaaccagagccatatcgcctgccag
tgcaaccatttgaccagctttgctgttttgatggacatttcaaaacgggagaatggggag
gtacttcctctgaagattgtcacgtacacaactgtttccatctcattggtggctttgctg
attaccttcatcctgctggttctgatccgcacgctgcggtccaacttgcacagcatccac
aagaacctggtggctgcccttttcttctccgagctcgtcttcctcattggaatcaaccaa
actgaaaacccgttcgtatgtacagtgattgccatcctcctgcactacttctacatgagt
acctttgcatggatgttcgtggagcagctccacatctaccggatgttgactgaagtgagg
aacatcaactttgggcacatgaggttctactacgtcgttggctggggcattcctgccatt
atcacagggcttgctgttgggctggacccacaaggctatgggaaccctgatttctgctgg
ctgtctgttcatgacacccttatctggagttttgctgggcccattgtaattgttgtagtg
ataaacactgtcatctttatactagcaatgaaagcatcatgcagacgaagacaancgttc
attgaaaaaactggagtcatctcagtgctgcggacagcattccttctccttctgctcatc
agtgccacgtggctcctggggctgatggcagtgaacagcgatgtcatgacgtttcactat
ctctttgccattttcagctgcctgcaggggctgttcattttcttcttccactgcgtcttt
aacaaagaagtcaggaagcacttgaagaacactttaactggaaagaaacctcttccagat
gattccactgcaacaagagctacattattaactcgatctctgaactgtaacaacacatac
atagaagagccaaatatgtatcgcacaactattggggaatccactgtctcccttgagagc
accgtcaggtcagccaagagccacaatagctaccttgcttatatcctcagggatgatgct
gctcataagctcagtggatcctcaagtcaagcaagggctggccagactgaagcagattcc
tccatttttcacaggaatccatctaaatccaatgagcatgactcagactctgacagcgaa
ctgtcccttgatgagcacagtagctcttacgcctcctcccattcatcagacagtgaagaa
gacgggcttgagccagagaaaaagtggaacacatccactgccaaaaataatgagcgtggc
cctctccacagcacacctaaagttgatacccttcccaatcatgtgaaaccctattggccc
acagagtgcataacggccagcgacagcgaggaccccagcgggaaacagaaactcaaagtt
gagaccaaggtcaacgttgagcttcacagggagaaccaggtgaaccacagcaatgaagca
ccgcaggacaaagagaatgatgggcagcagaaggagaacagacctctgtcccaccagaac
aaccagcagccggagcagaggaaaggcatcttaaaaaataaagtcacctaccctccccca
ctgattgacaagaatatgaagaatcggctgcgagaaaagctgtcagattacaatcagacc
acgatctcatccaggactacttcccttgggactaacgatggggtccgctctccttcagac
tcgggggtgacagtaaaaaatgctcggagggagcagtctcgagaccagctcaatggcatg
gccatgaacgtccatgtgggaacaggacatgctgagacatcagactcagagaagctgtga

DBGET integrated database retrieval system