KEGG   Gallus gallus (chicken): 426087
Entry
426087            CDS       T01006                                 

Gene name
PBX4
Definition
(RefSeq) pre-B-cell leukemia transcription factor 4
  KO
K15611  pre-B-cell leukemia transcription factor 4
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    426087 (PBX4)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, PBC
    426087 (PBX4)
SSDB
Motif
Pfam: PBC Homeodomain Homeobox_KN HTH_3 Sec15
Other DBs
NCBI-GeneID: 426087
NCBI-ProteinID: XP_423764
CGNC: 10094
Ensembl: ENSGALG00000034076
Position
30
AA seq 431 aa
MEDPSRLMAPHGAGVALQGGLPPGGPTAPTATPGDPSAVPPPGPPPHDTGDVLQQIMAIT
DQSLDEAQARKHALNCHRMKPALFSVLCEIKEKTVLSIRGIQEEDPPDAQLMRLDNMLLA
EGVSGPEKRGRGAPMAVAATPGGCPNDNSIEHSDYRAKLSQIRQIYHSELEKYEQACSEF
TTHVMNLLREQSRTRPISPKEIERMVNIIHGKFSTIQMQLKQSTCEAVMILRSRFLDARR
KRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKGGITVSQVSNWFGNKRIRYKKNM
GKFQEEANIYAAKTAVDATNVVAQGNRANSPSTPNSASSGSFKMTNSGDSFINLQSLTSY
QSSPVGGNVQSQMDSLHHVIHQAGRYDTIVGNPLYTTQRIDANGSWQDATTPSSITSPAG
DPGSVNSDASN
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggaggacccttcgcggttgatggcaccgcacggagccggggttgctctccaggggggt
ctccctccggggggtcccactgcccccaccgctactccgggggatccgagcgctgtgccc
cccccgggccctcccccccacgatacgggcgacgttctgcagcagattatggccatcacc
gatcagagcttggatgaggcccaggcgaggaaacacgccctgaactgccacaggatgaag
cctgctctgttcagtgtgctctgtgagatcaaggagaaaacagtgttaagtattcgtggt
attcaggaagaagacccccccgatgcccaactaatgaggctagataacatgttgctggcg
gagggcgtctccggccccgagaaaagaggaagaggagcaccgatggctgtagcagcaaca
ccaggtggctgtccaaatgacaatagcattgagcactctgactacagggccaagctgtca
cagatccgacagatataccactctgagctagagaaatatgaacaggcctgcagcgagttc
accacccacgtcatgaacctgctcagggaacagagccggacgaggcccatttctcccaaa
gaaatcgagcggatggtgaacatcatccacggcaaattcagcaccattcagatgcagctg
aagcagagcacgtgcgaggcggtgatgatcctccgctcacgcttcctcgatgcaaggcgt
aaacggcgtaacttcagcaagcaggcaacagaagtgctgaatgagtatttctattcgcac
ctgagcaacccttaccccagcgaagaggccaaagaggagctcgcaaagaagggtggcatc
accgtttcgcaggtttccaactggttcggtaacaaaagaattcggtacaagaagaacatg
gggaagttccaagaagaagccaacatttacgctgcgaaaacagcggtggatgcgaccaac
gttgtggctcagggcaaccgggcaaactccccatcaacaccaaattcggcttcctctggc
tcttttaagatgaccaattctggagattccttcataaatctgcagtcgttgacctcctac
cagagctccccggtgggaggcaacgtgcagtcacagatggattccttgcaccatgtcata
caccaggcaggaagatatgacaccattgtggggaatcctttgtacacgacgcagcgcatc
gacgcgaatggcagctggcaggacgcgaccaccccttcatccatcacctcacccgccgga
gaccctgggagcgttaattccgacgcgtccaattaa

DBGET integrated database retrieval system