KEGG   Gallus gallus (chicken): 426098
Entry
426098            CDS       T01006                                 

Gene name
GATAD2B
Definition
(RefSeq) LOW QUALITY PROTEIN: transcriptional repressor p66-beta
  KO
K23194  transcriptional repressor p66
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    426098 (GATAD2B)
   03036 Chromosome and associated proteins [BR:gga03036]
    426098 (GATAD2B)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    426098 (GATAD2B)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Chromatin remodeling factors
   NuRD complex
    426098 (GATAD2B)
SSDB
Motif
Pfam: P66_CC GATA LIM FAM76 DUF4004 DZR
Other DBs
NCBI-GeneID: 426098
NCBI-ProteinID: XP_015128639
CGNC: 66497
Ensembl: ENSGALG00000038200
Position
25
AA seq 591 aa
MDRMTEDALRLNLLKRSLDQADERDDVLAKRLKMEGHEAMERLKMLALLKRKDLSGIEVP
HELPVKQDGVKVYEEKLNGSLRPHGDGRTAGRPGKENINDEPVDMSARRSDQDRGRLTPS
PDIIVLSDNEASSPRSSSRMEERLKAANLEMFKGKSIEERQQLIKQLRDELRLEEARLVL
LKKLRQSQLQKENVVQKTPVVQNAASIVQPSPAHVGQQGLSKLPSRPGAQGVEPQNLRTL
QGHSVIRSATNTTLPHMLMSQRVIAPNPAQLQGQRVPPKPGLIRTTTPSMNPAINYQPQS
SSSVPCQRTSSSAIYMNLASHIQPGTVNRVSSPLPSPSALSDAANSQAAAKLALRKQLEK
TLLEIPPPKPPAPLLHFLPSAANSEFIYMVGLEEVVQSVIDSQGKSCASFLRVEPFVCAQ
CRTDFTPHWKQEKNGKILCEQCMTSNQKKALKAEHTNRLKNAFVKALQQEQEIEQRLQQQ
AALSPTAAPAVSSVGKQENIMRHHTLRQAPQPQSSLQRGIPTSARSMLSNFAQAPQLSVA
GGLLGMPGVNIAYLNAGIGGHKASSLADRQREYLLDMXPPRSISQSISGQK
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggacaggatgacagaggatgctctgcgcctcaacctcctgaagcggagcttggaccag
gcagacgagcgggacgacgtgctggccaagaggctgaagatggagggccacgaggccatg
gagcggctgaagatgctggcgctgctgaagaggaaggacctgtcgggcatcgaggtgccc
cacgagctgccggtgaaacaggatggggtgaaagtgtacgaggaaaagctgaatgggagc
ctgaggccccatggggatggcaggactgcagggaggccgggcaaggagaacattaacgac
gagccggtggatatgagcgccaggaggagtgaccaggaccggggccggctcaccccctcc
ccagacattatcgtcctctccgacaacgaggcctccagcccccgctccagctctcgcatg
gaagaaaggctgaaggcggccaacctggagatgttcaaggggaagagcatagaggagcgg
cagcagctcatcaagcagctccgggacgagctgcggctggaggaggccaggctggtgctg
ctgaagaagctgaggcagagccagctgcagaaggagaacgtggtacagaagactccggtt
gtccagaatgcagcgtctatcgtccagccatctcctgctcacgtgggacagcagggactg
tccaagctgccctccaggcctggagctcagggggtcgagcctcagaacttaaggacatta
cagggtcacagtgtcattaggtctgccacaaacacgaccctgccccatatgcttatgtct
cagcgtgtgattgctccaaaccctgcccagctgcaggggcagcgcgttcctcctaagcct
ggcctcatccgcactacaactccaagcatgaatccagccatcaactaccagccgcaatca
agttcttctgttccttgccagcgtacgtcgtcttcagccatctacatgaaccttgcctct
cacatccagcctggcaccgtcaaccgggtttcctccccgctccccagccccagcgcgctg
agcgacgccgccaactcgcaggcagccgccaagctggccctgcgcaaacagctggagaaa
accctgctggagatcccaccccccaaaccgcccgcgccgctgctgcacttcctgcccagc
gcagccaacagcgagttcatctacatggtggggctggaggaggtggtgcagagcgtcatc
gacagccaagggaagagctgcgcgtccttcctgcgcgtggagcccttcgtctgcgctcag
tgccgcaccgacttcaccccgcattggaagcaggagaagaacgggaagatcctctgcgag
cagtgcatgacgtccaaccagaagaaggcgctgaaggccgagcacaccaacaggctgaag
aacgccttcgtcaaagctttgcagcaggagcaggagatcgagcagaggttgcagcagcag
gcagccctgtcccccaccgcggctccggccgtctccagcgtcggcaaacaggagaacatc
atgaggcaccacacgctccggcaggctccgcagccccagagctctctgcagcgcggcatc
cccacctcagcccgctccatgctctccaacttcgcgcaggcgccgcagctctcggtggcg
ggggggctgctcggcatgccaggcgttaacatcgcgtatctgaacgccggcatcgggggg
cacaaagcgtccagcctggcggaccggcagcgcgagtacctcctggacatgnatcccccc
cgctccatatcgcagtccatcagcggacagaaatag

DBGET integrated database retrieval system