KEGG   Gallus gallus (chicken): 426234Help
Entry
426234            CDS       T01006                                 

Gene name
SEMA3BL
Definition
(RefSeq) semaphorin-3B isoform X3
  KO
K06840  semaphorin 3
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: Sema PSI
Motif
Other DBs
NCBI-GeneID: 426234
NCBI-ProteinID: XP_015148975
CGNC: 10271
Ensembl: ENSGALG00000013722
Position
12
AA seq 827 aa AA seqDB search
MRVCARSQVRLQVLAGGRVPARVCTCLHARVPPGRPPPPGPAPPRRGRPAALPRCRGAGR
SRAGPGRAAPSPARGPRSSPGHEPPAAPAAAPAAARRPLPAPAATPRLRLSFPELRARHG
LRLFQLERSCCYEALLLDEERSRLFVGAKNHLLSLSLDNISQRDRKIYWPAPVEWREECN
WAGKDITADCMNFVKILHAYNRTHLYACGTGAFHPTCAFVEVGQHTEDHVFKLDARRAED
GKGKSPYDPRHAAASVLVGEELYSGVATDLMGRDFTIFRSMGSRPSVRTEQHDSRWLNEP
KFVDVFWVPESENPDDDKIYFFFRETAVERQQGLGKASVSRIGQICRNDVGGQRSLVNKW
TTFLKARLVCAVPGTDGADTHFDELRDVFLLQTRDKRNPLVYAAFSTSSSIFQGSAVCVY
TMADIRRAFLGPFAHKEGPNYQWVPYQARVPYPRPGMCPSRTFGTFSSTKDFPDEVIQFA
RHHPLMYNPVLPHGQRPLFLQAGVPHTFTRIAVDRVAAADGHYDVLFIGTDVGTVLKVVS
APQQSWHGMEPLLLEELQVFQDASPIASLQLSSKRQQLYAGSATAVAQLPLHRCGAYGKA
CAECCLARDPYCAWDGTACTRFVPSTKRCVGPRGALPRPQRGDDGRGVSSRRALAGPRAP
TAAVRGGGQQRFPGVRAPLAACPRRVDVPARSRRSPARGAAGREGGADGAGAAPAQRAAA
RRRALRVPGHRAGLHAARAAPGAGRPQRRRPRGPRSLVPGLPAAARAARGGLRADAAPPS
RPGRAPRAAAGRDGAGAGGGAEPRAARRRRTRGGPRAERGPRSASAR
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgtgcgcgcgctcgcaggtgcgtctgcaggtgctcgcaggtggccgcgtgccc
gcgcgtgtttgcacgtgtctgcacgcgcgtgtacccccgggccgccccccgccgcccggc
cccgccccgccccgccggggccgccccgccgccctcccgcgctgccgcggcgcggggcgg
agccgtgcgggaccgggccgagccgcgccgagcccagcccgggggccgcgatccagcccc
ggccatgagccgcccgccgctcctgctgctgctcctgctgctgcccgccgcccgctgccc
gcacctgccgccaccccgcgcctccggctgtccttcccggagctgcgggcccgccacggg
ctgcgactcttccagctggagcgctcgtgctgctacgaggccctgctgctggatgaggag
cgcagccgcctcttcgtgggcgccaagaaccacctgctgtcactgagcctggacaacatc
agccagcgggacaggaagatctactggccggctccggtggagtggagggaggagtgcaac
tgggccggcaaggacatcacagccgactgcatgaacttcgtgaagatcctgcacgcctac
aaccggacccacctgtacgcctgcggcaccggcgccttccaccccacctgcgccttcgtg
gaggtgggccagcacaccgaggaccacgtcttcaagctggatgcgcggcgcgctgaggat
ggcaaagggaagagcccctacgacccccggcacgcggccgcctccgttctcgtgggcgag
gagctctactcgggggtggccaccgatctgatggggcgcgacttcaccatcttccgcagc
atgggctcccgcccgtccgtccgcacggagcagcacgactcccgctggctcaatgagccc
aagttcgtggatgttttttgggtgccggagagcgagaaccccgacgacgacaaaatctac
ttcttcttccgcgagacggcggtggagcggcagcaggggctgggcaaggccagcgtcagc
cgcatcggccagatctgcaggaacgacgtgggcgggcagcgcagcctggtgaacaagtgg
acgacgttcctcaaggcgcgcctggtgtgcgccgtgcccggcaccgacggcgccgacacg
cactttgatgagctccgtgacgtcttcctgctgcagacgagggacaagcgcaaccctttg
gtctatgctgccttctccacctccagctccatcttccagggctcggccgtctgcgtttac
accatggccgacatccgccgggcgttcctgggcccctttgcgcacaaggagggccccaac
taccagtgggtgccataccaggcgcgcgtgccgtacccccgcccgggcatgtgccccagc
agaaccttcggcaccttcagctccaccaaggacttcccggatgaggtgatccagtttgcc
cggcaccacccactgatgtacaacccagtgctgccccacggccagcggcccctcttcctg
caagccggcgtgccccacaccttcacccgcatcgccgtcgaccgcgtggctgccgccgat
ggccactacgacgtcctcttcattggcacagatgtgggcaccgtgctgaaggtggtctcg
gcaccgcagcagagctggcacggcatggagccgctgctgctggaggagctgcaggtcttc
caggacgcgtcccccatcgccagcctgcagctctcctccaagcggcaacagctctacgcc
ggctcagccaccgccgtggcccagctgcccctgcaccgctgcggcgcctacggcaaggcg
tgcgccgagtgctgcctggcacgggacccgtactgcgcctgggacggcaccgcctgcacc
cgcttcgtgcccagcaccaagaggtgcgtggggccgcggggcgcgctgccgcgcccgcag
cggggagacgacggacgcggggtgtcgtcccgcagagccctcgcagggccgcgtgcccca
acggcagctgtacggggtggagggcagcagcgctttcctggagtgcgtgccccgctcgct
gcgtgcccgcgtcgcgtggacgtaccagcgcggtcccgacgctccccagcgcgaggtgca
gccggacgagagggtggtgcggacggagcgggggctgctcctgcgcagcgtgcagcggca
cgacgccgggctctacgtgtgccgggccaccgagcagggcttcacgcagcccgtgctgcg
cctggcgctgggcgtcctcagcgccgccgcccccgggggccgcgctccctggtaccggga
cttcctgcagctgctcgagcggcccgaggcggcctgcgggcggatgcggcccccccctcc
cgccccggccgggccccccgcgcggcagcggggcgggacggagccggagccgggggcggt
gcggagccgcgggccgcccgccgccgccgtacccggggcgggccgagagccgagcgcggc
ccccgcagcgcctccgcccggtga

DBGET integrated database retrieval system