KEGG   Gallus gallus (chicken): 426289
Entry
426289            CDS       T01006                                 

Gene name
POLR2I
Definition
(RefSeq) DNA-directed RNA polymerase II subunit RPB9 isoform X1
  KO
K03017  DNA-directed RNA polymerase II subunit RPB9
Organism
gga  Gallus gallus (chicken)
Pathway
gga03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    426289 (POLR2I)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gga03021]
    426289 (POLR2I)
   03400 DNA repair and recombination proteins [BR:gga03400]
    426289 (POLR2I)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     426289 (POLR2I)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      426289 (POLR2I)
SSDB
Motif
Pfam: RNA_POL_M_15KD TFIIS_C Ogr_Delta TF_Zn_Ribbon
Other DBs
NCBI-GeneID: 426289
NCBI-ProteinID: XP_004951141
CGNC: 10365
Ensembl: ENSGALG00000038595
Position
16
AA seq 167 aa
MRGAAMESEGPSEPGFVGIRFCQECNNMLYPKEDKESRVLLYAVRPHGSGTSHGPSTAPS
RVPQSWARAVTLPTPISAPQCRNCDYQQEADSSCIYVNKITHEVDELTQIIADVSQDPTL
PRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE
NT seq 504 nt   +upstreamnt  +downstreamnt
atgcgcggagccgccatggagtcggagggtccgtctgagccgggtttcgtgggcatccgc
ttctgccaggagtgtaacaacatgctgtaccccaaggaggacaaggagagccgcgtgctg
ctttatgcggtgagaccccacggctcgggcacctcccacgggcccagcacagccccgagc
cgcgtccctcagagctgggcccgggccgtgaccctccccactcccatctctgccccccag
tgccgcaactgcgactaccagcaggaggccgacagcagctgcatctacgtcaacaagatc
acgcacgaagtggatgagctcacgcagatcatcgctgatgtctcccaggaccctacactg
ccgcgcactgaggaccacccctgccagaagtgcgggcacaaggaggctgttttcttccag
tcgcacagtgcaagagctgaggatgccatgaggctctactatgtctgcacagctccgcat
tgtggccaccgctggaccgagtga

DBGET integrated database retrieval system