KEGG   Gallus gallus (chicken): 426299
Entry
426299            CDS       T01006                                 

Gene name
MXD1
Definition
(RefSeq) max dimerization protein 1
  KO
K09114  MAX dimerization protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    426299 (MXD1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    426299 (MXD1)
SSDB
Motif
Pfam: HLH KASH_CCD APG6_N BPL_N
Other DBs
NCBI-GeneID: 426299
NCBI-ProteinID: NP_001034399
CGNC: 10387
Ensembl: ENSGALG00000013882
UniProt: Q5ZJ78
Position
22
AA seq 206 aa
MAAVGDDGSGVGSSIGLLLEAAEYLERRERGTGTPPFPPRHLPVPPGAARSRCVPTEAEH
GYASLLPGAGRARRESPRRRGKGRRSGGGGRSTHNEMEKNRRAHLRLCLEKLKVLVPLGP
ESSKHTTLSLLMKAKLHIKKLEDYDRRALHQIEQLQREQRHLKRQLEKLGSERVRTDSVG
SAVSSERSDSDRGETCTSLDSIWRSH
NT seq 621 nt   +upstreamnt  +downstreamnt
atggcggcggtcggtgacgacgggtccggcgtcgggtccagcatcgggctgctcctggag
gcggccgagtacctggagcggcgggagcgaggtaccggcaccccgccgtttcccccgcgg
cacctcccggtgcctcccggcgctgcccgctcccgttgtgtccccacagaggccgagcac
ggctacgcctcgctgctgcccggagcaggccgagcccgcagggagagcccgaggcgccgc
gggaagggccggaggagcggcgggggcggcaggtcaacgcacaatgagatggaaaagaac
aggcgtgcccacctgcggctgtgtttggagaagctgaaggtgctggtgccgctcggcccc
gaatccagcaagcacaccacgctgagtttactcatgaaagccaaattgcacatcaagaag
ctcgaggactacgacaggagagccctccaccagattgagcagctgcagcgcgagcagcgg
cacctgaagcggcagctggagaagttgggcagtgagagggtccgcaccgacagcgtcggc
tccgccgtgtcctcggagcgctccgactcggacagaggtgagacctgcacatctctggac
agcatctggaggtcccactga

DBGET integrated database retrieval system