KEGG   Gallus gallus (chicken): 426354
Entry
426354            CDS       T01006                                 

Symbol
SLC27A2
Name
(RefSeq) bile acyl-CoA synthetase
  KO
K08746  solute carrier family 27 (fatty acid transporter), member 2 [EC:6.2.1.- 6.2.1.3]
Organism
gga  Gallus gallus (chicken)
Pathway
gga03320  PPAR signaling pathway
gga04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    426354 (SLC27A2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    426354 (SLC27A2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gga01004]
    426354 (SLC27A2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gga02000]
    426354 (SLC27A2)
Enzymes [BR:gga01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     426354 (SLC27A2)
    6.2.1.-  
     426354 (SLC27A2)
Lipid biosynthesis proteins [BR:gga01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   426354 (SLC27A2)
Transporters [BR:gga02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   426354 (SLC27A2)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 426354
NCBI-ProteinID: XP_015128752
CGNC: 10467
Ensembl: ENSGALG00000034772
Position
31:complement(5675692..5682747)
AA seq 619 aa
MLGVLVAAVAGLLLLLLLHGRWFPFLWADLGAFVALVGSSLRCRWRLSRRPPITLLQVFQ
SHARRRPHHPLLLFQDEVYTFSDMERRSNRAARAFALRLGLQPGQTVAVFLPNVPAYVWT
WLALAKLGCAMACLNCNVRGRALLHARSAARADIVLSCSELQAAVEEVLPDLKQEGVRVF
YLNSTSPTPGVEALLPAIEAASDEPMPQYHTNTTTASKAIYIYTSGTTGLPKAAVVTEMK
VMMVANLARICGLRENDIVYTTLPLYHSAGLLIGVGGCLEVGATCVLRAKFSASQFWDDC
RRYNVTVIQYVGELMRYLCNSPRRANDREHGVRLAIGNGLRATVWKEFLQRFGPISISEF
YGATEGNAGFINYTGKIGAVGRVNVFLKAFASFELIKYNVEEDEPVRNEHGFCIRVRPGE
TGLLVIKITKSTPFHGYAGDSQKTEKKILRDVFVKGDAFFNSGDLLMMDQEKFLYFQDRV
GDTFRWKGENVATTEVEATLAMVDFIQEVNVYGVPVPGCEGKCGMAAVRLKPGQSFDGES
LYTFTRDTLPIYAAPRFVRIQNVLEITGTFKQCKGNLVKEGFDPNIITDPLFFRDEKKKS
YVPMNPNIYANILDGSLNL
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgctgggcgtgctggtggcagccgtggccgggctgctgctgctgctgctgctgcacggc
cgctggttccccttcctctgggctgacctgggagccttcgtggctttggtgggctcatcc
ctgcggtgtcggtggcgcctgtcccgccggccccccatcaccctcctgcaggttttccaa
agccacgctcgacgccgaccccaccacccgctgctgctgttccaggatgaggtgtacacc
ttcagtgacatggaacggaggagcaaccgcgctgcccgcgccttcgctctgcgcctgggc
ttgcagccgggccaaaccgtggctgttttcctccccaacgtgcccgcctatgtctggaca
tggctggctctggccaagctgggctgtgccatggcgtgcctcaattgcaacgtgcggggc
cgtgcgctgctgcatgcacggagcgctgcgcgggcagacatcgtgctcagctgtagtgag
ctccaggccgccgtggaggaagtgctgccagacctgaagcaggaaggtgtccgtgtcttc
tatctcaactccacatcgcccacaccaggggttgaggctctgctgcccgccatcgaggcc
gcctctgacgagccaatgccccaataccacaccaacactaccactgcctccaaagccatc
tacatctacacctccggcaccactgggctgcccaaagcagcggtggtcacagagatgaag
gtgatgatggtggccaacctggcacggatctgtggcctgcgagaaaatgacatcgtgtac
acaacactaccgctctaccactcggccgggctgctcattggggtgggaggctgcctcgag
gtcggagccacctgcgtcctgcgagccaagttctctgcctcccagttctgggacgactgc
cgccgctacaacgtcaccgtcatccagtatgtgggcgagctcatgcgctacctctgcaac
tcacccaggcgtgccaatgaccgggagcatggggtgcgtttggcgataggcaacggcttg
cgggcaacggtgtggaaggagttcctccagcgcttcggccccatctccatcagtgaattt
tatggggccactgaaggcaacgctggcttcatcaactacactggcaagatcggggccgtg
ggcagggtcaatgtgttcctcaaggcttttgcttcctttgagctgatcaagtacaacgtg
gaggaggatgaacctgtacgcaatgaacatggattctgcatccgcgtccgccccggtgaa
acggggctgctggtcatcaaaatcaccaaaagcacccctttccacggctacgcgggcgat
tcccagaagacagagaagaagatcttgagagatgtctttgtgaaaggtgacgccttcttc
aacagtggtgacctcctcatgatggaccaggaaaaattcctctatttccaggaccgtgtt
ggggacaccttccgctggaaaggtgagaacgtggccacgaccgaggtggaggccactctg
gccatggtggacttcatccaggaggttaatgtctatggggtgcctgtgccagggtgtgag
gggaagtgtggcatggcggctgtgcgcctgaaacccggacagagctttgatggcgagagc
ctctacaccttcaccagggacacgctgcccatctatgctgcaccccgcttcgtgcggatc
cagaatgtcctggagatcaccgggaccttcaagcaatgcaagggcaaccttgtcaaagaa
ggctttgaccccaacatcatcacagacccgctcttcttccgcgacgagaagaagaaatcc
tatgtgcccatgaacccaaacatctacgccaacatcctggatgggagcctcaacctgtag

DBGET integrated database retrieval system