KEGG   Gallus gallus (chicken): 426396
Entry
426396            CDS       T01006                                 

Gene name
SGTA
Definition
(RefSeq) small glutamine-rich tetratricopeptide repeat-containing protein alpha
  KO
K16365  small glutamine-rich tetratricopeptide repeat-containing protein alpha
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    426396 (SGTA)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   426396 (SGTA)
SSDB
Motif
Pfam: TPR_1 SGTA_dimer TPR_8 TPR_2 TPR_11 TPR_17 TPR_7 TPR_14 TPR_16 TPR_12 TPR_10 TPR_19 TPR_9 TOM20_plant BTAD DUF627 Fis1_TPR_C XPC-binding STI1
Other DBs
NCBI-GeneID: 426396
NCBI-ProteinID: NP_001026550
CGNC: 52773
Ensembl: ENSGALG00000014067
UniProt: A0A1D5PBJ5 Q5ZHW6
Position
28
AA seq 312 aa
MADQKRLAYSIIQFLHDQLQNGGLSPDAQESLEVAIQCLETAFGVSLEDQGLAVSRTLPE
IFEAAAGKEPEHIRANSEPVTPSEDDIAEAERLKTEGNEQMKAENFEAAVSFYGKAIELN
PSNAVYFCNRAAAYSKLGNYAGAVRDCERAIGIDPNYSKAYGRMGLALSSLNKHTEAVVY
YKKALELDPDNDTYKSNLKIAEQKMKETPSPTGGPGGFDLAGLLNNPGFMSMASNLMNNP
QVQQLMSGMISGGHNPMGAAGTSPSTNDLASLIQAGQQFAQQMQQQNPELIEQLRSQIRS
RTPSASNEDQQE
NT seq 939 nt   +upstreamnt  +downstreamnt
atggcagaccagaagcgccttgcatactccatcatccagttcttacatgaccagctacag
aacgggggtctttctccagatgctcaggagagtttagaagtggcgatccagtgcctggag
acagcttttggagtctccctggaagaccaaggcctcgcagtgtcgcggactctccctgaa
atatttgaagctgctgcaggaaaggagcctgaacacatcagagcaaactcggagccagtc
accccctctgaagatgacatagctgaagctgaaaggctcaagactgaaggaaatgaacaa
atgaaggcagagaactttgaagctgctgtgtctttctacggaaaagcaattgagttaaat
ccatccaatgctgtgtatttttgcaacagagctgctgcatacagtaaattaggaaattat
gctggagcagtcagagactgtgaaagagcaataggcattgatccaaactacagcaaagct
tacggcagaatgggcttggccctctccagtttaaataaacacacagaagctgttgtctac
tacaaaaaagccctggagcttgatccagacaacgacacgtacaaatccaaccttaaaata
gccgaacagaaaatgaaggagactcctagtccgaccggaggtcctggaggattcgattta
gctggcttgctgaacaaccctggcttcatgagtatggcatctaacctaatgaacaatcca
caagtacaacagctcatgtctgggatgatttctggtggccataaccccatgggagcagca
ggcaccagcccctccacgaatgatcttgccagcctcatacaagcgggccagcagtttgcg
cagcagatgcagcagcagaatcctgaactaatagagcagctacgaagccagatcaggagt
cgaactccaagtgccagcaatgaagatcagcaggaatga

DBGET integrated database retrieval system