KEGG   Gallus gallus (chicken): 426469
Entry
426469            CDS       T01006                                 

Gene name
ANKRD52
Definition
(RefSeq) serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C
  KO
K15504  serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    426469 (ANKRD52)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gga03400]
    426469 (ANKRD52)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-6
    Regulatory subunits
     426469 (ANKRD52)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   Other DSBR factors
    Protein phosphatase 6
     426469 (ANKRD52)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_3 Ank_5
Other DBs
NCBI-GeneID: 426469
NCBI-ProteinID: NP_001012957
CGNC: 52797
Ensembl: ENSGALG00000031973
UniProt: Q5ZLC8
Position
33
AA seq 1073 aa
MGILSITDQPPLVQAIFNRDVEEVRSLLNQKENINVLDQERRTPLHTAAYIGDVAILELL
ILSGANVNAKDTVWLTPLHRAAASRNEKALHLLLKHSADVNARDKYWQTPLHVAAANRAT
KCVEAIIPLLSTVNVADRTGRTALHHAVHSGHLEMVNLLLNKGASLSTCDKKDRQPIHWA
AFLGHLEVLKLLVARGADVMCKDKKGYTLLHTAAASGQIEVVRHLLRLGVEIDEPNSFGN
TALHIACYMGQDAVANELVNYGANVNQPNEKGFTPLHFAAVSTNGALCLELLVNNGADVN
FQSKEGKSPLHMAAIHGRFTRSQILIQNGSEIDCADKYGNTPLHVAARYGHELLISTLMT
NGADTARRGIHDMFPLHLAVLFGFSDCCRKLLSSGQLYSIVSSLSNEHVLSAGFDINTPD
NLGRTCLHAAASGGNVECLNLLLSSGADLRRRDKFGRTPLHYAAANGSYQCTVTLVTAGA
SINEADCKGCTPLHYAAASDTYRRAETHSGNSHDTDEEPLKESRMKEAFFCLEFLLDNGA
DPSLRDKQGYTAVHYAAAYGNRQNLELLLEMSFNCLEDVESTIPVSPLHLAAYNGHCEAL
KTLAETLVNLDVRDHKGRTALYLATERGSTECVEVLTSHGASALVKERKRKWTPLHAAAA
NGNTDSLHLLIDSGERADITDVMDIHGQTPLMLAIMNGHVDCVHLLLEKGSTADAADKRG
RTALHRGAVTGCEDCLAALLDHDAFVLCRDFKGRTPIHFASACGHLEILRTLLQAALSTD
PLDSVVDYSGYSPMHWASYSGHEDCLELLLEHNPFAYLEGNPFTPLHCAVINNQDSTAEM
LVEALGAKIVNSRDAKGRTPLHAAAFADNIHGLQLLLRHQAEVDTTDKLGRTPLMMASEN
GHTAAVEFLLYQAKANITVLDVNKNTALHLACSKGHEKCALLILGETQDLGLINASNSAL
QMPLHIAARNGLATVVQALLSRGATVLAVDEEGHTPALACAPNKDVADCLALILSTMKPF
PPKDAISSFSFNLLKNCGIAAKTAACGALPNGSTCPYSKDRHNAIGLDGCYSE
NT seq 3222 nt   +upstreamnt  +downstreamnt
atggggattctcagcatcacggaccagcctcctctggtccaagccatcttcaaccgcgat
gtagaggaagtgcggtcgctgctgaatcagaaggagaatatcaatgtactggaccaagaa
agacgaacacctctgcatactgctgcctacataggagatgttgcaatcctcgagctcctc
atactgtcaggtgctaatgttaacgcaaaggacactgtttggctcaccccgttacaccgc
gctgcggcttctcgcaacgagaaagcacttcacctcctcctgaagcactcggcagatgtc
aatgcccgcgacaagtactggcaaacgcctctgcatgtcgctgctgccaaccgggccacc
aagtgtgtggaggccatcatccccctgctgagcactgtcaatgtcgcggaccgcacgggc
cgcacggcgctgcaccacgccgtgcacagcggccacctcgagatggtgaacctgctgtta
aacaaaggggccagcctgagtacttgcgataagaaggatcgccagcccatccactgggca
gcttttctagggcatttggaagttctgaagctgctggtggcccgtggagctgatgtgatg
tgtaaggacaagaagggctacaccctgctgcacacggctgcagccagcgggcagatcgaa
gttgtgcgtcacctgctgcggctgggcgtggagatcgatgaaccaaattccttcggtaac
actgcacttcacattgcctgttacatgggccaagatgccgtggccaacgaactggtcaat
tacggcgccaatgtcaatcagcctaacgagaagggcttcacccctctgcactttgctgct
gtctccaccaatggggccctgtgcctagagctccttgtcaacaacggggccgacgtcaac
tttcagagtaaggaagggaaaagccccttgcacatggctgccatccacgggcggttcacg
cgttcgcagatcctcattcagaatggcagtgagattgactgtgctgacaaatacggcaat
acccccctccacgttgctgctagatatggccatgagctgctaattagtactttgatgacg
aatggtgctgacactgcaaggcgtgggatccacgacatgttccctctgcacttagctgtt
ctctttggattttcagactgttgtcgtaagctactttcctcaggtcagttgtacagtatc
gtctcctcgctgagcaacgagcacgtgctgtctgcaggctttgatatcaacacacctgac
aaccttgggaggacttgcctccacgctgctgcttctggagggaacgttgaatgtcttaat
ttgctgttgagcagcggtgctgacttgaggaggagagataaattcggaaggactccactg
cactacgcagctgccaacggcagctatcagtgtacggtgacattggtcactgcaggagcc
agtattaatgaggctgactgtaaaggctgtacccccttacactatgctgctgcttcggac
acgtacaggagagcagagactcattcaggaaacagccatgacactgatgaggagccactg
aaggagtccaggatgaaggaggcattcttttgtttagagttcttgctggataatggtgct
gacccatccctccgggacaaacagggttatactgctgtccactatgcagctgcatatggc
aacaggcagaacctcgaactgctcctggaaatgtcttttaactgcctggaggatgtggaa
agcaccattccagtcagccctttgcacttagctgcctataatggtcactgtgaagccctg
aagacacttgctgaaaccctcgtgaacctggacgtgcgggaccacaaggggcggacagcc
ctgtacctcgccacggagaggggctccactgagtgcgtggaggtgctcaccagccacggc
gcatctgccctggtgaaggagaggaagaggaagtggacccctctccatgctgcagctgcc
aacgggaatactgattccctgcacctcctgatagacagcggggagcgggcagacatcacc
gatgtcatggacatccacggccaaaccccactgatgctggcgatcatgaacggccacgtt
gactgtgtccacctcctcctggagaagggatccacagctgacgcagccgacaagagagga
aggaccgctctgcatcggggggctgtgacgggctgtgaggactgcctggctgctctgctg
gaccacgatgccttcgttctgtgtcgggatttcaaaggccggaccccgatccactttgca
tcggcgtgcgggcacttagaaatcctgaggaccttgctgcaggcagccctctctactgac
cctctggactctgttgtggactacagcggttactcaccaatgcactgggcttcatacagt
gggcatgaagattgtcttgaattgttacttgaacacaatccatttgcatacctagaagga
aacccctttactccattgcactgtgcagtaattaacaaccaggacagcactgctgaaatg
ctggtggaagcattaggtgccaagattgttaatagcagagatgccaaaggaaggacaccc
cttcacgctgctgcctttgcagacaacatccatggtttacagctgcttctgcgccaccaa
gccgaggtggacacaactgacaagctggggaggactcccctcatgatggcctctgagaac
gggcacactgcagcagttgagttcctgctgtaccaagcaaaagcaaatataactgtgctg
gatgtcaacaagaacacagctcttcacctggcctgcagcaagggtcatgaaaagtgtgcc
ttgttgatcctgggggaaacccaagaccttggccttatcaatgcaagtaacagtgctctg
cagatgccgctccacatcgctgcacggaatgggctggccaccgttgtccaggccctgctc
agcagaggtgccaccgtgctggctgtggatgaagaaggtcataccccagccttggcatgc
gcccccaacaaggacgttgccgactgcctggcacttatcctctccaccatgaagcctttc
ccacctaaagacgccatcagctctttcagcttcaacctcctcaagaactgcggcattgca
gccaaaaccgcggcctgcggggccctgcccaacggcagcacctgcccctacagcaaggac
cggcacaatgccatcggcttagacggctgttactcggagtag

DBGET integrated database retrieval system