KEGG   Gallus gallus (chicken): 426534
Entry
426534            CDS       T01006                                 

Gene name
AK3
Definition
(RefSeq) GTP:AMP phosphotransferase AK3, mitochondrial isoform X1
  KO
K00944  nucleoside-triphosphate--adenylate kinase [EC:2.7.4.10]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00230  Purine metabolism
Module
gga_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    426534 (AK3)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.10  nucleoside-triphosphate---adenylate kinase
     426534 (AK3)
SSDB
Motif
Pfam: ADK AAA_17 ADK_lid AAA_18 AAA_33 Cytidylate_kin RNA_helicase
Other DBs
NCBI-GeneID: 426534
NCBI-ProteinID: XP_015135676
CGNC: 10745
Ensembl: ENSGALG00000014447
UniProt: A0A1D5PHA6
Position
Z
AA seq 227 aa
MAPPPLLRAVIMGPPGSGKGTISARIIKHFGMKHLSSGDLLRVNMQKKTEVGILAKSYID
QGRLIPDDIMTRLILNELKGLDQYNWLLDGFPRTVAQAEALDKECQIDTVIDLDVPFETI
KCRLTARWVHPTSGRVYNLEFSPPKVQGIDDVTGEPLVQRDDDKPETVTKRLQAYDAQTK
PVLEYYRKKGLLKSFSGTETNKIWPHIYTFLQTKLPDVSQKDAATPR
NT seq 684 nt   +upstreamnt  +downstreamnt
atggcgccgccgccgctgctacgcgccgtcatcatgggcccgccgggctccggcaagggc
acgatctcggcgcggatcatcaagcacttcggcatgaagcacctctctagcggagatttg
ctgagggtcaacatgcagaagaagacagaagttggaatccttgccaagtcctacattgat
caaggaaggcttattccagatgacatcatgacacggctgatactaaatgagctaaaaggt
ctagatcagtacaactggctgctggatggtttccctagaacagttgctcaggcagaagcc
ctggataaagaatgtcaaatagacactgtgattgacctagacgtaccatttgaaaccata
aaatgtcgtctcactgcacggtgggtacaccctactagtggcagagtctacaaccttgaa
ttcagtcctcccaaagtgcagggcattgatgacgttactggagagccacttgttcaacga
gatgatgataagccagagacggttaccaagagactgcaggcttatgatgcacaaacaaaa
cctgttctagaatattatcggaaaaaagggctgttgaaatccttctctggaacagaaact
aataaaatctggccacatatctacactttcctccaaaccaagttgccagatgtgagccag
aaagatgctgccactcccaggtga

DBGET integrated database retrieval system