KEGG   Gallus gallus (chicken): 426548
Entry
426548            CDS       T01006                                 

Symbol
TGOLN2
Name
(RefSeq) trans-Golgi network integral membrane protein 2
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: KCT2
Other DBs
NCBI-GeneID: 426548
NCBI-ProteinID: XP_015128437
CGNC: 66504
UniProt: A0A3Q2TU86
Position
22:5310488..5315034
AA seq 445 aa
MALRLLSLLLLLLLLLLGIAAEAANGNDVGTGGAGGGQESERSESNPSVKDEESNKAQNE
GNRGTANEERGAGDEEQKKDQSEQGKNPSGETGQQSGKEEEKNTEGQDTNQNNGGQSGSN
TASQPSTQNSDSQSNTQGGDDHGQNTHNSNHQDSKTNSQDSQQPGSQTEQNGNTDGKNGQ
EDGNTDGQNGQKDNSGGANSQTNQQSNSNPQDNNTNKQTNQQDSSKPEGENTDKQTTQQG
SSNSQDNNTNKQTNQQGSGGQDGEKTDKQTTQQGNGKPQDNNTNKQTDQQGSSNPQDNNT
NKQTDQQGSSNQQGDNTNTQEGNQGGHADSLGNNGQSSQSVSSVHETEGSPDGEELPEEE
GGVRNGNGAASLNKEREKSVPISPGEKSENSHFFAYLVTTAIIVAALYVAYHNKRKIIAF
ALEGKRSKSGRRPKSGDYQRLDQKI
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggcgctgcggctgctctcgctcctcctgctgctgctactgctgctgcttggcattgct
gccgaggccgcaaacgggaatgatgttgggaccgggggcgcaggtggggggcaggaatca
gagcgctcagagtccaacccttcagtaaaagacgaagaatccaacaaggcacaaaatgaa
ggtaacagagggacagcaaatgaggagagaggtgcaggtgatgaagagcaaaagaaagac
cagagtgagcaggggaagaacccgtccggagagacagggcaacaatctggcaaagaggaa
gaaaaaaacactgagggccaagacaccaaccagaacaatggcgggcagtctggcagcaac
actgctagccagcccagcacccagaacagtgacagccaaagcaacacccagggtggtgac
gatcatgggcaaaacacccacaacagcaaccatcaggacagtaagaccaacagccaagac
agccagcagccgggcagtcagaccgagcaaaatggcaacactgatggcaaaaatggccag
gaagatggcaacaccgatggccaaaatggccagaaagacaacagtggcggtgccaacagc
cagaccaaccagcaaagcaacagcaacccacaagataacaacaccaacaagcagaccaac
cagcaagacagcagcaagccggaaggtgagaacactgacaagcagaccacccagcaaggc
agcagcaactcacaagataacaacaccaacaagcagaccaaccagcaaggcagcggcggc
caggatggtgagaagactgacaagcagaccacccagcaaggaaacggtaaaccacaagat
aacaacaccaacaagcagaccgaccagcaaggcagcagcaacccacaagataacaacacc
aacaagcagaccgaccagcaaggcagcagcaaccagcaaggtgacaacaccaacacgcag
gaaggcaatcagggcggccatgcagactcattgggaaataatggccagtcctcacagtca
gtttcatctgttcatgagaccgaaggctctccagatggggaggagctccccgaggaagag
ggtggggttagaaatggtaacggtgctgcctcgcttaataaggagagagagaagagtgtt
cccatttctccaggggagaagtcggagaacagccacttctttgcctatctggtgaccacg
gctattattgtcgccgctctgtatgttgcctatcacaacaaacgaaagatcatcgctttt
gccctggaagggaaacgatcaaaaagcggtcggcggcccaaatctggcgattatcagcgc
ctggatcaaaagatctag

DBGET integrated database retrieval system