KEGG   Gallus gallus (chicken): 426584Help
Entry
426584            CDS       T01006                                 

Gene name
MATN2
Definition
(RefSeq) matrilin-2 isoform X1
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: FXa_inhibition VWA cEGF EGF_CA EGF VWA_2 hEGF Matrilin_ccoil EGF_3 Plasmod_Pvs28 Sec23_trunk HSBP1
Motif
Other DBs
NCBI-GeneID: 426584
NCBI-ProteinID: XP_025003819
CGNC: 10792
Position
2
AA seq 1276 aa AA seqDB search
MSLYFLKMKTMIAYYFLLFGHALLCTVSIMAKDLPVGHFTRRRDVSSQSLLENTCNNKRL
DLVFIIDSSRSVRPYDFEKVKEFILTILQFLDVSPDATRVGLIQYGSTVKHEFSLKTFRR
KQEIERAVRRMMHLATGTMTGLAIQYAVNIAFSESEGARPLNQNVPRIIMIVTDGRPQDP
VGEIAAKARNSGILIFAIGVGRVDMNTLKSIGSEPHEEHIFLVANFSQIETLTSVFQTKL
CVPHMCSIAEHRCDHFCINTPGSYVCRCKQGYILNADQRTCSTQDLCAVEKHNCEQICVN
TPGSYVCQCYEGYELDADGKNCVVVDYCAVDNQGCQHECVNTEDSYYCRCHPGFILNPDK
RTCRRPDYCALQDHGCEQECVNTDDSYFCRCQEGFRLNPDKKTCKRVDHCAENDHGCEQL
CLNTDDSYVCQCSEGFVINEDLRTCSRVDYCVLSDHGCEHLCINGDKSYTCQCFEGYRLR
NDGKTCKRKNVCKSVNHGCEHVCVSTDNSYICKCREGFILRDDGKTCRRQDICKSISHGC
EHICVNKDDSYACECHEGFLLREDGKTCRYKDICSSVDHGCEHVCVNADESYICQCYEGF
ALRQDGKTCRNKDVCNSVDHGCEHVCVNTDNSYICQCYEGFVLREDEKTCKSKDICKSVN
HGCEHLCVNGDDSYTCQCHDGFVLRQDGKTCRSKDICKSVNHGCEHACVNAGDTFVCKCQ
EGFLLREDGKTCRNKDLCKSVNHGCEHVCVNTDDSYICKCHDGFLLREDGKTCKNKDICN
SINHGCEQVCVNSGESYVCKCHENFILKEDGKTCKYKDVCKSVNHGCEHICVNTDDSYIC
KCHDDFILREDGKTCRSKNICKTVNHGCEHVCVPAGDSYACQCHKGFTLRRDRKTCRNKD
LCKSIDHGCEHVCISNNNSYSCQCREGFVLRQDGKTCRSKDVCKSVAHGCEHICVNNDDS
YICKCQEGYVLKEDQKTCRRCTEGPVDLVFVIDGSKSLGEDNFEIVKQFVSGILDTLEIS
PKAARVGLLQYSSEVRTEFTLRRFSTAKDMKKAVSQMKYMGRGSMTGLALKQMFERSFTE
TEGARPLSANIPRISIVFTDGRAQDEVSEWAARAKRSGIIIYAIGIGKAIEEELLEIASE
PSYKHLFYAEDFTAMEDISEELKVQICEALRNSAHQQHLSSGRLHRTNPQPSGPESTTVE
ITDVLACPSLAIQHKYLFEDSQSHSTRTTAKTSKDQCKCENLVTFQNYATNEVRRLTQRL
EEMTKRMEDLENRLKY
NT seq 3831 nt NT seq  +upstreamnt  +downstreamnt
atgtccctctacttcttgaaaatgaagacaatgattgcatattactttttgctgttcggg
cacgctctactttgcactgtctctatcatggcaaaagatctccctgtaggacattttacc
cgaagaagggatgttagctctcaatctctactagaaaatacttgtaacaacaaacgtctg
gaccttgtcttcatcattgatagctctcgcagcgtacgtccctatgactttgaaaaagtg
aaagagttcattttaacgatcttgcagttcctggacgtcagtcctgatgccactcgagta
ggcctgattcagtatggcagcactgtcaaacatgaattctctctgaagacgtttaggagg
aaacaggagatcgagagagcagtgaggagaatgatgcacctggcaactggcaccatgacg
ggactggctatccagtatgctgtgaacatcgcgttttcagagtcagaaggagctcgacct
ctgaaccaaaacgtgcctcgcattatcatgatagtgacagatgggagaccgcaggatcca
gtgggagaaattgctgctaaagctcgcaactctggaattctgatttttgccattggagtg
ggaagagtggatatgaacacactcaaatccattgggagtgagccacacgaagagcacatc
tttctagttgctaatttcagtcagattgaaacgctgacctctgtcttccagactaaactt
tgtgtgccccatatgtgcagtatagctgagcatcgctgtgatcatttctgcataaatact
ccaggctcctatgtatgcagatgtaaacaaggttacatcctgaacgctgaccagaggact
tgcagcactcaagacctctgcgctgtggagaagcataactgtgagcagatttgtgtgaac
acgcctgggtcttatgtctgtcagtgttacgaagggtatgagcttgatgcggatgggaag
aattgtgttgttgtggactactgtgctgtggataatcaaggttgccaacatgaatgtgtt
aacacagaggactcttattactgtagatgccacccagggttcattttaaatccagacaaa
agaacttgcagaagaccagactactgtgctcttcaggaccatggctgtgaacaggaatgt
gttaatacagatgattcctatttctgtcgatgccaagaagggtttagacttaatccggat
aagaaaacatgcaaaagagtggaccactgtgcagagaacgatcacggttgtgagcaactg
tgtctgaatactgatgactcctacgtctgtcagtgctctgaaggatttgtcatcaatgag
gacctacgaacctgctcacgagttgactattgtgttctgagtgatcacggctgtgaacat
ttgtgtataaatggtgacaaatcttacacttgccagtgttttgaaggatacaggcttcgg
aatgatgggaaaacatgtaaacgtaaaaatgtctgcaaatcagtcaaccatggctgtgag
catgtttgtgttagtactgacaattcttacatctgcaagtgccgtgaagggttcatattg
agagatgatggaaaaacatgcagaagacaggacatctgcaaatcaatcagccatggctgt
gagcatatttgtgttaacaaagatgattcttatgcttgcgagtgtcacgaaggtttccta
ttgagagaagatgggaaaacatgcagatataaagacatttgcagttcagttgaccatggc
tgtgaacatgtttgtgttaatgctgatgagtcatacatctgccagtgttatgagggattt
gcattaagacaagatggaaaaacatgtagaaataaagatgtttgcaattctgttgaccat
ggctgtgagcacgtttgtgtgaacactgataattcatacatttgccagtgttatgagggt
tttgtattgagggaagatgagaaaacatgtaaaagtaaggacatctgcaaatcagtcaat
catggctgtgaacatctttgtgttaatggtgatgactcatatacttgccaatgccatgac
ggatttgtactgaggcaagatgggaaaacatgccgaagcaaggatatttgcaaatcagtc
aaccatggctgtgaacatgcctgtgttaatgctggtgatacatttgtttgtaagtgtcag
gagggattcctgctaagagaagatggaaaaacatgcagaaataaagatctttgcaagtca
gtcaaccatggctgtgaacatgtttgtgttaatactgatgattcatatatttgcaaatgc
catgatggatttctactgcgagaagatgggaaaacctgtaaaaacaaggatatttgcaat
tcaatcaaccatggctgtgaacaagtttgtgtgaattcaggagaatcctacgtgtgcaag
tgtcacgaaaatttcatactgaaggaagatggaaagacatgtaaatataaagatgtttgc
aaatcagttaaccatggctgtgaacacatttgtgttaacactgacgattcctatatctgc
aagtgtcacgatgacttcatactgagggaagatgggaaaacttgtagaagtaaaaatata
tgcaaaacagtcaaccacggttgtgaacatgtctgtgttccagctggtgattcatacgca
tgtcagtgccacaagggatttacactgaggagagataggaaaacatgcaggaataaagac
ctgtgtaagtccattgaccatggctgtgaacatgtatgcatcagtaataacaattcatac
agctgtcagtgccgtgagggatttgtcctgcgacaagatggaaaaacatgtcgaagcaaa
gatgtctgcaaatcagttgcccatggttgtgaacatatttgtgttaataatgatgattca
tacatctgcaaatgtcaggaggggtacgtactaaaggaggatcagaaaacctgcagaaga
tgcactgaaggcccagttgacctggtgtttgtgatcgatggatcaaaaagtctcggagag
gataattttgaaattgtgaaacaattcgtctcaggaatattggatacacttgagatttca
cccaaagctgctcgagttggtttgcttcagtattcctctgaagtccgcacagaatttaca
ttaagacggttcagcacagccaaagacatgaagaaagctgtatcacaaatgaaatatatg
gggagaggttccatgacaggactggctctgaagcaaatgtttgagaggagcttcacagaa
acagaaggagccagaccactgtcagcaaacatccctcgaatctccattgtgtttacggat
ggacgagcccaagatgaagtctctgagtgggctgctagggcaaagagaagtggtataatt
atctatgccattggaataggaaaagcaattgaagaagaactgctggaaattgcttctgag
ccatcgtataaacatctcttttatgctgaggatttcacagcaatggaggacataagcgaa
gagctcaaagttcaaatctgtgaagccttgagaaattcagctcaccagcaacatctgtca
tctggaaggctccataggactaatccacaaccatcaggacctgaatcaaccacagtagaa
atcacagatgtccttgcctgtcccagtcttgcaatacagcataagtatctttttgaagac
agtcaaagtcactcaacaagaacaacagcaaaaacttctaaagaccaatgcaaatgtgaa
aacctggtgacgttccagaactacgcaaccaacgaagtaagaagactcacgcagcgattg
gaagaaatgacaaagagaatggaagacttggaaaacagactgaaatactga

DBGET integrated database retrieval system