KEGG   Gallus gallus (chicken): 426622
Entry
426622            CDS       T01006                                 

Gene name
BORCS8
Definition
(RefSeq) BLOC-1-related complex subunit 8 isoform 1
  KO
K20822  BLOC-1 related complex subunit 8
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    426622 (BORCS8)
Membrane trafficking [BR:gga04131]
 Endosome - Lysosome transport
  Arf GTPases and associated proteins
   BLOC-one-related complex (BORC)
    426622 (BORCS8)
SSDB
Motif
Pfam: BORCS8
Other DBs
NCBI-GeneID: 426622
NCBI-ProteinID: NP_001243435
CGNC: 52843
Ensembl: ENSGALG00000014581
UniProt: E1C745
Position
28
AA seq 121 aa
MEEPEMQLKVKKVTDKFTESMYVLANEPSVALYRLQEHVRRSLPELAQHKSDMQSWEEQS
QGAIYTVEYACSAIKSMTDSSVYFKSIDSLLKHAIAMKDQLNAAQGRSAVAPQAKNPPGS
S
NT seq 366 nt   +upstreamnt  +downstreamnt
atggaggagcccgagatgcagctgaaggtgaagaaagttacagacaaattcacagagagc
atgtatgtgctggccaacgagccctctgtggccctgtaccgactccaggagcacgtccgg
cgatcgcttccagagctcgctcagcacaagtctgacatgcagagctgggaggagcagagc
caaggagccatctacaccgtggagtacgcctgcagtgccataaagagcatgaccgacagc
agtgtgtacttcaagagcattgacagtctgctcaagcatgccattgccatgaaggatcag
ctgaacgccgctcagggccgcagtgctgttgccccacaagccaagaatcctccaggtagt
tcctga

DBGET integrated database retrieval system