KEGG   Gallus gallus (chicken): 426623
Entry
426623            CDS       T01006                                 

Gene name
RFXANK
Definition
(RefSeq) DNA-binding protein RFXANK
  KO
K08062  regulatory factor X-associated ankyrin-containing protein
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank_3 Ank
Other DBs
NCBI-GeneID: 426623
NCBI-ProteinID: NP_001026560
CGNC: 66506
Ensembl: ENSGALG00000037261
UniProt: Q5ZKT2
Position
28
AA seq 283 aa
MEGEEEAPVNDGDNQELLKEEIENGAEGAAATEEPAGTRDTGDGGAPPGLLQMDRGLQGS
SCMEGGTNALLKPSAASTDRQRTPELSTLDSFPLKHSNTLTNRQRGNEISALPATLDTLS
IHQLAAQGELSQLKKHLQKGENLVNKPDERGFTPLIWAAAFGEIETVRHLLEWGADPHAL
AKERESALSLASMGGYTDIVIMLLERNVDINIYDWNGGTPLLYAVRGNHVKCVEALLARG
ADLTTEADSGYTPMDLAVALGYKKVQQVIENHILKLFQNKGLE
NT seq 852 nt   +upstreamnt  +downstreamnt
atggaaggtgaagaagaggcccccgtgaacgatggggacaaccaggagctcctgaaagaa
gagattgagaatggagctgagggagcagcagccacggaggagccagctgggaccagggac
actggggacggcggtgcccccccggggctactgcagatggacaggggcctgcagggctcc
agctgcatggaaggtggaacaaacgctctcctgaagccctcagctgcctcaacggacagg
caaaggactcctgaactctcaacccttgacagcttccccctgaagcactcaaacacactg
acaaacaggcagcgaggcaatgagatctcagccctcccagccaccctggacacgttgtcc
atccatcagctagctgcccagggtgagctcagccagctgaagaagcatcttcagaaaggt
gagaacttggtaaataaacctgatgagagaggcttcacaccactgatctgggctgcagcc
tttggagagatcgaaacagtccgtcacctgctggaatggggcgctgacccccatgcgctg
gcaaaggagagggagagtgccctgtccctggccagcatgggtggctacactgacatcgtc
atcatgctgctggagaggaacgtggacatcaacatctatgactggaatggtggtactcct
ctgctctacgccgtgcgtggcaatcacgtcaagtgtgtcgaggccctcctagctcgtggt
gctgacctgacgacagaagcagattctggctacaccccgatggatctggctgtggctctg
ggatacaagaaagtccaacaggttattgaaaatcacatcctgaagctatttcagaacaag
gggctggagtga

DBGET integrated database retrieval system