KEGG   Gallus gallus (chicken): 426857
Entry
426857            CDS       T01006                                 

Gene name
ATP8B1
Definition
(RefSeq) phospholipid-transporting ATPase IC
  KO
K01530  phospholipid-translocating ATPase [EC:7.6.2.1]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    426857 (ATP8B1)
Enzymes [BR:gga01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     426857 (ATP8B1)
SSDB
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Cation_ATPase Hydrolase E1-E2_ATPase Hydrolase_3
Other DBs
NCBI-GeneID: 426857
NCBI-ProteinID: NP_001264704
CGNC: 2363
Ensembl: ENSGALG00000030834
UniProt: A0A1D5PRN3
Position
Z
AA seq 1249 aa
MSSERDSETTFDEDSQPNDEVVPYSDDDTEDELDSQQPAIEPVQNRINRGTEESQEPLKK
DCSWQVKANDHHFYEQPQFKRKIFLCFKKSKYAGNAIKTYKYNLITFLPLNLFEQFKRAA
NSYFLVLLILQAIPQISTLSWYTTLVPLLLVLGITAVKDLVDDIVRHRMDNEVNNRTCEV
IREGRFKNTKWKDIKVGDIIRLKKNTFVPADILLLSSSEPNSLCYVETAELDGETNLKFK
MALEVTDRYLQEEKAMADFNGLIECEEPNNRLDKFTGTLFWRNRSYALDADKILLRGCKI
RNTDFCHGVVIFAGADTKIMKNSGKTKFKRTKIDSLMNYMVYTIFVVLILLSAGLAIGHT
YWEQQIGNSSWYLYDAQDYSPPYRGFLNFWGYIIVLNTMVPISLYVSVEVIRLGQSYFIN
WDLQMYYPEKDTAAKARTTTLNEQLGQIHYIFSDKTGTLTQNIMTFKKCCINGQRYGDCR
DSAGQLPSHPEQVDFSWNRYADGKFLFYDHYLIEQIRSKKEPEIQEFFLLLAICHTVMVD
VSDGQINYQAASPDEGALVTAARNFGYVFLSRTQNTITISEMGTERTYDVLAILDFNSDR
KRMSVIVRESNGNIRLYCKGADTVIFERLHPRNLKREATEEALDVFASETLRTLCLCYRD
ISHDEFEAWNKKFMEASVATSNRDEALDKVYEEIEKDLILLGATAIEDKLQDGVPETISK
LSKADIKIWVLTGDKKETAENIGFSCELLTDETTICYGEDISGLLQTRLENQRNRAGSST
HSSLRMNEPFFQGSRNRALIITGSWLNEILLEKKKKKKKKLRLKFPRTEEEKQKQMEKKR
RAEAYKEQQQKNFVDLACECKAVICCRVTPKQKAMVVDLVKKYKKAITLAIGDGANDVNM
IKTAHIGVGISGQEGMQAVMSSDYSFGQFRYLQRLLLVHGRWSYIRMCKFLRYFFYKNFA
FTLVHIWYSFFNGFSAQTAYEDWFITLYNVLYSSLPVLLVGLFDQDVSDKLSLRFPRLYI
LGQKDLLFNYKKFFRSLLHGAVTSMIIFFIPYGAYLQTMGQDGEAPSDYQSFAVTAATSL
VFVVNLQIGLDTSYWTFVNAFSVFGSIAIYFGITFDFHSAGIHVLFPSAFQFTGTAPNAL
KQLYLWLTMALTIAVCLLPVVAQRFLSMTISPSESDRIQKNRKKYLAEEEQWQRRQSAFR
RGVSARRSAYAFSHQRGYADLIASGRSIRKKRAPLAAVLGSTTGAAETS
NT seq 3750 nt   +upstreamnt  +downstreamnt
atgagttcagaacgggactcggagaccaccttcgatgaggattcccagcctaatgatgag
gtggtgccatacagtgatgatgacacagaggatgagctagacagccagcagcctgccatt
gaaccagtgcaaaatcgaatcaacaggggaaccgaggagagccaagagccgctgaaaaaa
gactgcagctggcaagttaaagcaaatgatcatcacttctatgaacagccccagtttaag
agaaaaatatttctatgcttcaaaaaaagcaaatatgctggaaatgcaattaagacatac
aagtacaaccttatcacttttttaccactgaatctgtttgaacagtttaaaagagcagcc
aactcctatttcctggtactcctcattttgcaggcaattccccagataagtactctgtca
tggtatacaacgctggtgcccttactcttggtgctgggaataactgcagtcaaagaccta
gtggatgacatagttcgtcacaggatggacaatgaggttaataatagaacatgtgaagtc
atcagggaaggaaggttcaaaaacacgaaatggaaagatattaaagttggtgatatcatt
cgtctgaagaagaatactttcgttcctgccgatattttgctgctatccagctcagaacca
aacagtctctgctacgtagagacggctgaactagatggtgagacaaacttaaaatttaaa
atggcccttgaggtaacagacaggtatcttcaagaggagaaagcaatggcagacttcaat
ggtctgattgagtgtgaagagcctaataaccgactggataagttcacaggaacattattc
tggagaaacagaagctatgcattggatgctgataagatcttgttacgtggatgcaaaatc
aggaatacagatttctgccatggagttgtcatatttgcaggtgctgatacaaaaataatg
aaaaacagtggaaagacaaaatttaagaggacaaaaattgactcccttatgaattacatg
gtttatactatattcgttgtcctcatcctgctttcggctggcctcgccatcgggcacacc
tactgggagcagcagattggcaactcatcttggtacctctacgacgcacaggactacagc
cctccgtaccgcggcttccttaacttctggggctatatcattgttctgaacactatggtt
cccatttctctctatgtgagcgtcgaagtgattcgtttgggccaaagttattttataaac
tgggacctgcaaatgtattaccctgagaaggacacggctgcaaaggccagaaccaccact
ctgaatgagcagctggggcagatccattatatcttctccgacaagacaggaactctcact
cagaacatcatgacatttaaaaaatgctgcataaatggccaaagatacggagactgccgg
gatagtgcaggccagctcccaagccacccagagcaagtggatttcagctggaacaggtat
gcagatggaaagttcttgttctatgatcactatctcatagagcaaataaggtcgaaaaaa
gaaccagaaatccaggagttctttcttctgctcgctatttgtcacacagtcatggtggat
gtttctgatggtcagatcaattaccaggcagcctccccagacgaaggggccttggttaca
gcggccagaaactttggctatgtttttctttcacgaacacaaaataccatcaccataagt
gaaatggggactgaaagaacttacgatgtccttgccatcttggatttcaacagcgataga
aaacgaatgtctgtcattgtaagagaatccaacggaaatatcaggctgtattgtaaagga
gctgatacagtaatttttgaacggttgcacccaaggaatttaaagagagaagcgacggaa
gaagcactggatgtttttgcaagtgaaactctaagaacactctgtctctgctatagagac
attagtcatgatgaatttgaagcatggaataaaaagttcatggaggccagtgtagctaca
agcaatcgtgatgaagctctggacaaagtatatgaggaaatagaaaaagacttgattctt
cttggtgcaacagctattgaagacaaactacaggatggagttccagaaactatttcaaaa
ctttcaaaagcagatattaaaatctgggtgcttactggagacaaaaaagaaactgctgaa
aatattggattttcgtgtgaactcttaacagatgaaacaacaatctgctatggggaagat
atcagtggtcttcttcagactaggttagaaaaccagaggaatagagctggatcaagcaca
cattcatctctaagaatgaatgaacccttctttcagggtagtagaaatcgtgccttaatc
attactggctcctggttgaatgaaatcctgctagagaagaaaaagaagaagaagaagaaa
cttagactgaaattccccagaacagaggaagagaaacaaaagcaaatggagaagaaaaga
agggctgaagcttacaaagagcagcagcagaagaattttgttgatttggcatgtgaatgc
aaggctgtgatctgctgtcgagtgactccgaagcaaaaagctatggtggttgatctcgtg
aagaaatacaagaaagctatcactttggctattggggacggtgccaatgatgtgaacatg
attaaaactgcccacattggagttggaatcagtggccaagaagggatgcaagctgtcatg
tccagcgactactcttttgggcagttccgctacctccagaggctgctgctggtccacggg
cgatggtcttacattaggatgtgcaagtttctaagatattttttctacaaaaactttgct
ttcacgctagtccacatctggtattcattctttaatggcttttctgcccagacagcatat
gaagactggttcatcacgctgtacaacgtgctgtattcgagtctcccagttctgttagtc
ggcttgtttgaccaggatgtgagtgacaaattgagtcttcggttcccaaggctgtacatt
ctgggacagaaagatttacttttcaattacaagaaattctttagaagtctgcttcatgga
gctgtaacttcaatgataattttcttcataccatatggagcttaccttcaaactatgggg
caagatggagaagcaccttcagattatcagtcatttgctgtcacagcagcaacttctctt
gtgtttgttgtcaaccttcagattggcttggatacatcttactggactttcgttaatgct
ttctcagtatttgggagtattgcaatttactttggtatcacatttgacttccacagtgca
ggaatccacgttctctttccttctgcttttcagttcacaggaactgctccaaatgctctg
aaacagctgtacctctggttgaccatggctttaacaattgctgtttgcttactccctgtg
gtggcacagcgtttcttatccatgaccatttctccttcagaaagtgatcgaatccagaag
aaccgtaagaagtacctggcagaagaggagcagtggcagcggaggcagagtgctttccgc
cggggggtgtctgctcggcgctctgcctacgccttctcccaccagaggggctacgccgac
ctcattgcctcggggcgcagcatccgcaagaagagagccccactggctgcagtgctgggc
agcacaacaggagctgctgaaacgagctga

DBGET integrated database retrieval system