KEGG   Gallus gallus (chicken): 426862
Entry
426862            CDS       T01006                                 

Gene name
IVNS1ABP
Definition
(RefSeq) influenza virus NS1A-binding protein isoform X2
  KO
K15046  influenza virus NS1A-binding protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gga04121]
    426862 (IVNS1ABP)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Multi subunit type E3 associated proteins
    426862 (IVNS1ABP)
SSDB
Motif
Pfam: Kelch_1 Kelch_6 Kelch_2 Kelch_3 Kelch_4 BTB Kelch_5 BACK
Other DBs
NCBI-GeneID: 426862
NCBI-ProteinID: XP_004949936
CGNC: 3814
UniProt: A0A1D5NXS8
Position
8
AA seq 641 aa
MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEI
FNSDSDSHGISHVKFDDLNPDAVEVLLNYAYTAQLKADKELVKDVYSAAKKLKMERVKQV
CGDYLLSKMDVQSCISYRNFVSCMGDSRLLSKIDGYIQEHLLQISEQEEFLKLPRLKLEV
MLEDNVGLPSNGKLYTKVINWVQRSIWENGDSLEDLMEEVQTLYYSADHKLLDGNLLDGQ
AEVYGSDDDHIQFVQKKPPRENDHKQISSSSSGSLSPSAAVQSPKHEWKIIASEKTSSNT
YLCLAVLDSVLCVIFLHGRNSPQSSPTSTPRLLKSLSFELQPNDVIEKPMSPMQYARSGL
GTAELNGKLIAAGGYNREECLRTVECYDPQRDIWTFIAPMRTPRARFQMAVLMGQLYVVG
GSNGHSDDLSCGEMYEPEIDDWTPVPELRTNRCNAGVCALNGKLYIVGGSDPYGQKGLKN
CDVFDPITKSWTSCAPLNIRRHQSAVCELGGHLYIIGGAESWNCLSSVERYNPENNTWTL
MAPMNVARRGAGVAVHDGKLFVGGGFDGSHAVSCMEMYDPAKNEWKMMGNMTTPRSNAGI
TTVANTIYAVGGFDGNEFLNTVEVYNSESNEWSPYTKIYKF
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgattcctaatggatatttgatgtttgaagatgaaaatttcatcgagtcatctgttgcc
aaactaaacgccttacgtaaaagtggtcagttctgtgatgtccgactccaggtatgtggg
catgagatgctggcgcacagagctgtgctagcttgctgcagtccctacctgtttgaaatc
ttcaatagtgatagtgattctcatggaatttctcatgttaaatttgatgatctcaatcca
gatgctgttgaagttcttttgaattatgcctatactgctcagttgaaagctgataaagaa
ctggtgaaagatgtatattctgcagcaaagaagttgaagatggaaagagtaaagcaggtc
tgtggtgactacttgctctccaagatggatgttcagagctgcatctcttaccgaaacttt
gtaagctgcatgggagactcacgcttgttgagcaagattgacggctacattcaggaacat
cttttgcagatttcagaacaggaggaattcctgaaacttccacggttaaagcttgaagta
atgcttgaagacaatgttggcctacccagcaatggcaaattatacacaaaggtaatcaac
tgggtacagcgcagcatctgggaaaatggagacagcctggaagatctgatggaagaggtt
caaacgctgtactactcagctgatcacaagctgcttgatggaaatctgctagatggacag
gctgaggtgtatggcagtgatgatgaccacattcagtttgtgcagaagaagccaccacgt
gagaatgaccacaagcagataagtagcagctcctctggaagtctttctccaagtgctgct
gtgcagagtcctaaacatgagtggaaaatcattgcttcagaaaagacttcaagcaacacc
tacctgtgtctggctgttctggacagtgtgctgtgtgtgatctttctgcatggccgtaac
agccctcagagctctcctacaagcacgccacgcctgctgaagagtctgagttttgaacta
cagccaaacgatgtaatagagaagcccatgtctcccatgcagtatgctcgatcagggttg
ggcacagctgagcttaatggcaagctaattgctgcaggtggctataacagagaggagtgt
ttgcgtacagtggaatgctatgatccacagagggacatttggactttcattgcacccatg
agaacacccagagctcggttccaaatggcagtcttaatggggcagctgtatgttgtgggt
gggtcaaatggtcactcggatgacttgagctgtggggaaatgtacgagccagaaatagat
gactggactcctgttccggagctgagaaccaatcgttgcaatgcaggagtatgtgccctg
aatggaaaactgtacattgttggtggttcagatccttatggccaaaagggacttaagaac
tgtgatgtgtttgatcccataacaaaatcttggacaagctgcgctcccctcaatatccgg
agacatcagtctgcagtgtgcgagctggggggccacctgtacatcattggtggggcagag
tcatggaactgcctaagcagtgtggagcgctacaatcctgagaacaatacctggaccctg
atggcacccatgaatgtggctcggaggggagctggagtggctgtgcatgacggaaaactc
tttgttggaggaggatttgatggttctcacgcagtgagctgcatggagatgtatgaccct
gctaaaaatgagtggaagatgatgggaaatatgaccactccaagaagcaatgctgggatt
acaactgtggcaaacactatttatgcggttgggggatttgatggcaatgaattcctgaac
acagttgaagtctacaactcagaatcaaacgaatggagcccgtacacaaaaatttacaag
ttttaa

DBGET integrated database retrieval system