KEGG   Gallus gallus (chicken): 426873
Entry
426873            CDS       T01006                                 

Symbol
ATF1
Name
(RefSeq) cyclic AMP-dependent transcription factor ATF-1 isoform X1
  KO
K09053  activating transcription factor 1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    426873 (ATF1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    426873 (ATF1)
SSDB
Motif
Pfam: bZIP_1 pKID bZIP_2 bZIP_Maf ASD2
Other DBs
NCBI-GeneID: 426873
NCBI-ProteinID: XP_004949774
CGNC: 4567
Ensembl: ENSGALG00000033614
Position
33
AA seq 412 aa
MRRPSLLSVVPGKRTTALSICWLLEDGFGCELGGTLGKLFYLKAALFGFSSYISWSNGAF
SPKPGIFADYGRGAQEQQQLRAALPALGRTRYSTAGSSALSYCSTETLGEGKNERRLREI
YILMDSTINKRMSLRGPAPLTVVQLPGEQVQVQGVIQTAQSSSVIHSPQVQTVQVSSLSE
SEDSQDSSDSIGSTQKARGILARRPSYRKILKDLSSEDTRDRKGDEESPGVSTVTSMSVP
TPIYQTSTGQYIAIAANGLQLASASADGVQGLQTLTMTNAGGTQPGTTILQYAQTSDGQQ
ILVPSNQVVVQTASGDMQTYQIRTTPTTTSLPQTVVMTSPVTLTSQSSKTDDPQLKREIR
LMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKTLKDLYCHKSV
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgcgccgtccttcactgctttcagtggttcctggaaaaagaactacagctctgtccatc
tgctggctgctggaagatggatttggctgcgagcttggcggaacgttggggaaattattt
tatttaaaagctgctttgtttgggttttcttcgtacatctcatggtccaatggtgcattt
tcaccaaaacccgggatattcgctgattatggaagaggtgcacaagagcagcagcagctc
cgtgccgccctcccagccctcggccgtacaaggtacagcactgcaggcagctcagctctc
tcatattgctcaacagaaacacttggagaaggaaaaaacgagagaaggttgagagaaata
tacatattgatggacagcacaattaataaaaggatgtctctgcgaggtcctgctcctctg
acagttgttcagcttcctggagagcaagtccaggtccagggagtgattcagacagcgcag
tcctcttctgtaatccactcaccccaggtgcaaacagtgcaggtgtcttctctgtctgag
agcgaggattctcaggactcatcagacagcataggctccacgcagaaagctcgggggatc
ttagcacgtcgtccatcttatcgaaaaattttgaaagatctctcttctgaagatacacgg
gatagaaaaggagatgaggaaagtcctggggtctctactgttacgtccatgtctgttccc
acacccatctaccagacgagcactggacagtacattgccattgctgcaaatggattgcag
ctggccagcgccagtgctgatggagtgcagggcctgcagacattaaccatgacgaatgct
ggtgggactcagcctgggacaacaatcctgcagtatgcacagacatcagatggccagcag
atactcgtacccagcaaccaggtggtagtgcagactgcatcaggagacatgcagacgtat
cagatccgcaccacgccgaccaccacgtccctccctcagactgtggtcatgacatctcct
gtcaccctgacgtcgcagtccagtaagacagacgatccacaactgaaacgagagataagg
ctgatgaagaacagagaagctgctcgagagtgccgtaggaagaagaaggaatatgtgaaa
tgtctggagaaccgagttgcagtcctggaaaaccagaacaaaactctaattgaagagcta
aaaactttgaaagatctttactgtcataaaagtgtgtaa

DBGET integrated database retrieval system