KEGG   Gallus gallus (chicken): 426874Help
Entry
426874            CDS       T01006                                 

Gene name
DIP2B
Definition
(RefSeq) disco-interacting protein 2 homolog B isoform X3
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding DMAP_binding GvpG
Motif
Other DBs
NCBI-GeneID: 426874
NCBI-ProteinID: XP_004949779
CGNC: 4607
Ensembl: ENSGALG00000034965
Position
33
AA seq 1501 aa AA seqDB search
MAEPAAAGISSLPREVREQLAELELELSEGDITQKGYEKKRAKLLAPYVPQTQGVDPALQ
KESRTQTPTPSATPAPAPSSSSSKFHRARSGGARDERYRSDIHTEAVQAALAKHKEQKMA
LPMPTKRRSTFVQSPADACTPPENFSVPPDVTATTSSSSTRPAAIDLPPSGIVKGMHKGS
NRSSLMDTADGVPVSSRVSTKIQQLLNTLKRPKRPPLKEFFVDDFEEIVEVPQPDPNQPK
PEGRQMTPVKGEPLGVVCNWPPALEAALQRWGTTQAKCPCLTALDVTGKPVYTLTYGKLW
SRSLKLAYTLLNKLGTKNEPVLKPGDRVALVYPNNDPVMFMVAFYGCLLAEVIPVPIEVP
LTRKDAGGQQIGFLLGSCGIALALTTEVCLKGLPKTQNGEIVQFKGWPRLKWVVTDSKYL
SKSPKDWQPNISAAGTEPAYIEYKTSKEGSVMGVTVSRIAMLSHCQALSQACNYSEGETI
VNVLDFKKDAGLWHGILTNVMNKLHTISVPYSVMKTCPLSWVQRVHTHKAKVALVKCRDL
HWAMMAHRDQRDVSLSSLRMLIVTDGANPWSVSSCDAFLSLFQSHGLKPEAICPCATSPE
AMTIAIRRPGVPGAPLPGRAILSMNGLSFGVIRVNTEDKNSALTVQDVGHVMPGGMMCIV
KPDGAPQLCKTDEIGEICVSSRAGGMMYYGLAGLTKSTFEVIPLNSAGSPVGDVPFVRSG
LLGFVGPGSLVFVVGKMDGLLTVSGRRHNADDIVATGLAVESIKTVYRGRIAVFSVSVFY
DERIVVVAEQRPDASEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKTPLGGIHIS
QTKQHFLEGSLHPCNILMCPHTCVTNLPKPRQKQPGVGPASVMVGNLVAGKRIAQASGRD
LGQIEDNDLVKKHQFLTEVLQWRAHTTPDHALFLLLNAKGTAVCTATCLQLHKKAERIAS
VLCDKGHLNAGDNVVLLYPPGIELITAFYGCLYAGCIPVTVRPPHAQSLTATLPTVRMIV
EVSKAACILTTQTLMRLLKSREAAAAVDVKTWPTIIDTDDLPRKRLSQIYKPPTSEMLAY
LDFSVSTTGMLTGVKMSHAAVSGLCRAIKLQCELYSSRQIAICLDPYCGLGFVLWCLCSV
YSGHQSILIPPMELESNLSLWLSTVSQHKIRDTFCSYSVMELCTKGLGNQVETLKARGIN
LSCVRTCVVVAEERPRVSLTHSFSKLFKDIGLSSRAVSTTFGSRVNVAICLQGTSGPDPT
TVYVDLKSLRHDRVRLVERGAPQSLLLSESGKILPGVKVVIVNPETKGPLGDSHLGEIWV
NSPHTASGYYTIYDNETLQADHFNTRLSFGDAAQTLWARTGYLGFVRRTELTAASGERHD
ALYVVGALDETLELRGLRYHPIDIETSVSRTHRSIAECAVFTWTNLLVVVVELCGCEQEA
LDLVPLVTNVVLEEHYLIVGVVVVVDPGVIPINSRGEKQRMHLRDSFLADQLDPIYVAYN
M
NT seq 4506 nt NT seq  +upstreamnt  +downstreamnt
atggccgagccggcggccgcgggtatctcctcgctgcctcgcgaggtccgcgagcagctg
gccgagctggagctggagctctctgaaggggacatcacacagaaggggtatgagaagaag
agagcaaagctcctggctccgtacgtccctcagacacaaggggttgatccagctctacag
aaggaatccagaactcagacacccactccatctgcaactccagccccagctccctcctca
tcctcatccaaatttcaccgagcccgctcagggggagccagagatgaacgctaccgatct
gatatccacacagaagcagttcaagcagcactggcaaaacacaaagaacagaaaatggcc
ctccccatgcccacaaaacggcgatctacatttgttcagtctccagctgatgcctgcact
cctccagaaaatttctcagttcccccagatgtcacagcaactacctcctcttcctctaca
cgcccagcagcaattgaccttcctccttcagggatcgtgaagggcatgcacaagggatcc
aatcggtccagtctgatggatactgccgatggtgttcctgtgagtagtagagtctccaca
aagattcaacagttgctgaacaccttgaagaggcctaagaggccacctctgaaagaattt
tttgtggatgactttgaagagattgtggaagttccacagcctgacccaaatcagcccaag
ccagaaggacggcagatgacccctgtgaaaggagaacccctgggagttgtttgtaactgg
cctcctgccttagaagcagcactgcagcgctggggaaccacacaagctaaatgtccctgt
ctgacagcactggatgttacaggaaaaccagtttataccctcacatacggcaaattgtgg
agcagaagtctcaagctggcctacacactgcttaacaaactggggaccaaaaatgaacct
gtgttaaaacctggagatagggtagcccttgtgtacccgaacaatgacccagtcatgttt
atggtggcattttacggctgtctcctagcagaagtgataccagtgcctatagaggtacct
cttaccagaaaggatgctggtggtcagcagattggttttcttctgggaagctgtggtatt
gctttggccctcaccactgaagtctgtctgaaagggcttccaaaaacccaaaatggagaa
attgtgcagtttaaaggttggcctagattgaaatgggttgtgacagattcaaaatacctc
tccaaatctcctaaggactggcagcccaacatctcagctgcaggaactgagccagcatat
attgagtacaagaccagcaaagagggcagtgttatgggtgtcacagtgtctcggattgca
atgctgtctcactgccaagctttgtctcaggcttgcaactattctgaaggtgaaacaata
gtgaatgttttggattttaagaaggatgcagggttgtggcacggcattctcacgaatgta
atgaacaaattgcatactatcagcgtgccctattctgtgatgaaaacctgcccactgtca
tgggtgcagagagttcatactcacaaagcaaaagttgctttagtcaagtgtcgagacttg
cactgggccatgatggcccatcgagaccaaagagacgtcagtttgagttctctacgcatg
ctgattgtaactgacggtgcaaatccctggtctgtttcctcatgcgatgccttcctgagc
ttgtttcagagtcatgggcttaaaccagaggcaatttgtccgtgtgccacatctccagaa
gcaatgactattgcaatacggagacctggggttcctggggcacctctgcctggaagagcc
atactgtccatgaatgggctgagttttggtgtgattcgtgtcaacactgaagacaaaaac
tctgcgctcactgttcaggatgttgggcatgtgatgccaggaggaatgatgtgtatagtg
aaacccgatggagcacctcagctgtgtaaaacagatgagattggagaaatctgtgttagc
tccagagcaggaggaatgatgtattacgggctggcagggctgacaaagagtacatttgag
gttattcctctgaactcagctggctctccagtgggtgatgtgccatttgtccgttctggc
ttgctgggctttgttggacctggcagtttggtgtttgtggttggaaaaatggatggattg
ctgacagtcagtgggcggagacacaatgctgatgacattgtcgcaactgggttggcagta
gagtcaataaaaacagtttacagaggaaggattgctgttttctcagtatctgtcttctat
gatgagaggattgtggtggtggcagagcagaggccagatgcatctgaggaggacagcttt
caatggatgagtcgtgtactgcaggcaattgacagcattcaccaagtgggcgtatattgc
cttgctcttgtgccagctaatacattgccaaaaactccgctgggagggatccatatctct
caaactaaacagcactttctggagggctctctgcatccatgcaacatcctcatgtgccca
cacacgtgtgtgacgaacttgccaaaacccaggcagaaacaaccaggtgtgggccctgcc
tctgtgatggtggggaacctggttgctgggaagcgtattgctcaagcctctggaagagat
cttggtcaaatagaagacaatgatttagttaaaaagcaccagttcctgacagaggtgtta
cagtggagagctcacacaactcctgaccatgcgctcttcctcttgttaaatgccaaggga
actgctgtgtgtacagccacctgccttcagttgcacaaaaaagctgagagaattgcatca
gtgctctgtgacaaaggacatctcaatgcaggagacaacgtggtgcttctttatcctcct
ggcattgagctaatcaccgcgttctatggctgtttgtatgctggctgcatccctgtgacg
gtgagaccacctcatgctcagagcctcactgctactctgcccactgtacgaatgatcgtg
gaagtcagcaaagctgcctgtattcttacaactcagaccttaatgagactactgaaatcc
agagaggcagctgctgctgtagatgtgaaaacctggccgaccatcattgatacagatgac
ttgcccaggaagcggctctctcagatctataaaccacctacgtctgaaatgttagcatat
ctagattttagtgtttccacaacgggcatgcttacaggagtgaagatgtcccacgcagca
gtgagtggcctttgcagggccatcaagcttcagtgtgagctctactcctcacggcagatt
gccatttgtcttgacccctactgtggactagggtttgtgctctggtgcctttgcagtgtg
tattctggacaccagtcaattttaattcctcctatggagctggaatccaatctttctctc
tggttatctactgtaagccagcataaaataagggacactttctgttcctattcagtcatg
gaactgtgcacaaagggacttggaaaccaagttgaaacgttaaaggcacgaggaattaat
ctgtcctgtgtccggacgtgtgtggttgttgcagaggaacgaccacgagtttctctcact
cattcattctcgaaactcttcaaagacattggcctgtcatctcgtgctgtaagcaccacc
tttggatcaagagtcaacgttgctatctgtttacagggaacctctgggcctgatcccacc
acagtgtatgtagatctgaaatccttgagacatgacagagtacgtctagtggaaagggga
gctccacaaagtctgctgctttcagaatctgggaagattttacctggagtcaaggtggtt
attgttaatccggagacaaaagggcctctgggagattctcatcttggagagatttgggtg
aacagcccacacacagccagtggctactacaccatctacgacaacgaaacccttcaagcc
gatcatttcaacactcgtctgagctttggagatgcagctcagacgctttgggctcggact
gggtaccttggttttgtccgtcggacagagcttacagctgccagtggagagcgccatgat
gcactgtatgttgttggagcactggatgaaactctggaactgagggggctgcgttaccac
ccaattgatattgagacgtctgtatctcggacgcacagaagcattgctgaatgtgctgta
ttcacatggaccaacttgctcgtggttgttgtggagctgtgtggctgtgaacaggaggcc
ctggatttagttcctctggttacaaatgtggtcctggaagaacattatctcattgtgggg
gtggtggtggtggttgatcctggagttattcctatcaattccaggggggagaaacaacgg
atgcatctccgtgacagttttctagctgaccagttagaccccatatatgttgcttataac
atgtag

DBGET integrated database retrieval system