KEGG   Gallus gallus (chicken): 426883
Entry
426883            CDS       T01006                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1
  KO
K04829  acid-sensing ion channel 1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    426883 (ASIC1)
Ion channels [BR:gga04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   426883 (ASIC1)
SSDB
Motif
Pfam: ASC DUF4074
Other DBs
NCBI-GeneID: 426883
NCBI-ProteinID: NP_001035557
CGNC: 66509
Ensembl: ENSGALG00000034025
UniProt: Q1XA76
Structure
PDB: 

Position
33
AA seq 527 aa
MMDLKVDEEEVDSGQPVSIQAFASSSTLHGISHIFSYERLSLKRVVWALCFMGSLALLAL
VCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLN
NRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQC
SPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDET
SFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEF
YDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYC
VCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIE
QKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHRLCRRGKCRKNHKRNNTD
KGVALSMDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgatggacctgaaggtggacgaggaggaggtggacagcgggcagccggtgagcatccag
gccttcgccagcagctccaccctgcacgggatctcgcacatcttctcctacgagcggctg
tcgctgaagcgcgtggtctgggcgctctgcttcatgggttcgctggcgctgctcgccctg
gtctgcaccaaccgcatccagtactacttcctctacccccacgtcaccaagctggacgag
gtggccgccaccaggctcaccttccctgctgtcaccttctgcaacctcaacgagttccgc
ttcagccgggtgaccaagaacgacctgtaccacgccggggaactcctcgccctgctcaat
aacagatacgagatcccggacacacagacagctgatgagaagcagctggaaatcctacag
gacaaggcaaacttccgaaacttcaagcccaaacctttcaatatgttggagttttacgac
cgcgccggccacgacatccgggagatgctgctctcctgcttcttccgtggggagcagtgc
agccctgaagacttcaaagtggtgttcacacgctatgggaagtgctacacgttcaacgca
gggcaggatggcaaaccccggctcatcaccatgaaggggggcactggaaatggcctggag
atcatgctggacatccagcaggacgagtacctcccagtgtggggggaaacagatgagacc
tcatttgaagccgggatcaaggtgcagatccacagccaggatgagcctccactcatcgac
cagctgggcttcggtgtggcacccggcttccagaccttcgtgtcctgccaggagcagcgg
ctcatctacctgccacctccctggggcgactgtaaggccacaacgggtgactcggagttc
tacgacacttacagcatcactgcctgccgcatcgactgcgagacccgctacctggtggag
aactgcaactgccgcatggtgcacatgccaggcgatgccccttattgcaccccagagcag
tacaaggagtgtgcagatccagccttagatttcctggtggagaaggacaatgagtactgt
gtctgtgagatgccctgcaacgtcacccgctatggcaaagagctctccatggtgaagatc
cccagcaaagcctccgccaagtacctggccaagaagtacaacaagtcggagcagtacatc
ggggagaacatcctggtgctggacatcttctttgaagccctgaactatgagacaatcgag
cagaagaaggcgtatgaggtggctggattgctgggtgacatcggaggacagatggggctg
tttatcggggccagcatcctcactgtgctggagctctttgactacgcctatgaggtgatc
aagcaccggctgtgccggcggggcaaatgccgcaagaaccacaagaggaacaacacggac
aagggcgtcgcgctgagcatggatgatgtgaaacgccacaacccctgtgagagcctacgg
ggtcacccggctggcatgacgtacgcagcgaacatcctacctcaccacccggcccggggc
acctttgaggacttcacctgctaa

DBGET integrated database retrieval system