KEGG   Gallus gallus (chicken): 426889
Entry
426889            CDS       T01006                                 

Gene name
CELF4
Definition
(RefSeq) CUGBP Elav-like family member 4 isoform X6
  KO
K13207  CUG-BP- and ETR3-like factor
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gga03041]
    426889 (CELF4)
Spliceosome [BR:gga03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    426889 (CELF4)
SSDB
Motif
Pfam: RRM_1 RRM_7 Nup35_RRM_2 RRM_5
Other DBs
NCBI-GeneID: 426889
NCBI-ProteinID: XP_003642973
CGNC: 52922
Position
Z
AA seq 473 aa
MYIKMATLANGQPDNTSLSSNHSNPSTNGHMNGLNHSPGNPSTIPMKDHDAIKLFIGQIP
RNLDEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCERESALKAQSALHEQKTLP
GMNRPIQVKPADSESRGEDRKLFVGMLNKQQSEDDVRRLFEAFGNIEECTILRGPDGNSK
GCAFVKYSSHAEAQAAINALHGSQTMPGASSSLVVKFADTDKERTMRRMQQMAGQMGMFN
PMAIQFGAYGAYAQALMQQQAAIMASVAQGGYLNPMAAFAAAQMQQMAALNMNGLAAAPM
TPTSGGSTPPGITAPAVPSIPSPIGVNGFTGLPPQANGQPAAEAVFANGIHPYPAQSPTA
ADPLQQAYAGVQQYAGPAYPAAYGQISQAFPQPPPMIPQQQREGPEGCNLFIYHLPQEFG
DAELMQMFLPFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDANRPY
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgtatataaagatggccacgttagcaaacggacaaccagacaataccagcctgagtagc
aatcacagcaaccccagcaccaacgggcatatgaacggattaaaccatagtcccggaaac
ccatccaccatcccaatgaaggaccacgatgccattaagctctttattgggcagatcccc
cgtaacctggacgagaaagacctcaaaccgctcttcgaggagttcgggaagatctatgaa
ctgacggtgctgaaggacaggttcactggcatgcacaaaggctgtgccttcctaacatac
tgcgaaagggagtctgctctaaaggcccagagtgcactgcatgaacagaagacactgcca
gggatgaatagaccgatccaggtgaaaccagcggacagcgaaagccgaggagaagacaga
aaactcttcgtgggcatgcttaataagcagcagtcagaagatgatgtgcgcaggctattc
gaggcatttggcaacattgaggagtgcacaatccttcggggacccgatggaaacagcaaa
ggctgtgcatttgtgaaatactcttcgcatgcagaggcccaagcagctatcaatgccttg
catggcagccagacaatgccgggagcctcttcaagcctggtggtgaagtttgcagataca
gacaaggagcgtacaatgaggcgcatgcagcaaatggcgggacaaatgggcatgttcaac
cccatggccatccagtttggagcatatggcgcctacgcacaggcactgatgcagcagcaa
gccgcgatcatggcttcggtggcgcagggcggatacctgaaccccatggcagcctttgct
gcagcccagatgcagcagatggcggctctgaacatgaatggcctggcagctgcccccatg
actccaacctcaggtggaagcacgcctcctggcataactgcaccagctgtgcctagcatc
ccatctccaattggggtgaatggtttcactggcctcccgccgcaggctaacgggcagccc
gccgcagaagccgtgtttgctaatggcatacacccttacccagcacagagccccactgca
gcagaccccttgcagcaagcctacgctggagtgcagcagtacgcaggtcctgcttatcct
gctgcttatggccagattagccaagcgttcccacagccacctcccatgataccacagcaa
cagagagaaggaccagagggctgtaacctgtttatctaccatctgccccaggagtttggg
gatgctgagctgatgcagatgttcctgcctttcggttttgtgagttttgacaatcctgcc
agtgcccaagctgccatccaagctatgaatggcttccagattggcatgaagaggctgaag
gtgcagctgaagaggccaaaggatgctaatcgtccctactga

DBGET integrated database retrieval system