KEGG   Gallus gallus (chicken): 426892
Entry
426892            CDS       T01006                                 

Gene name
AQP7
Definition
(RefSeq) aquaporin-7 isoform X3
  KO
K08771  aquaporin-7
Organism
gga  Gallus gallus (chicken)
Pathway
gga03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    426892 (AQP7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gga02000]
    426892 (AQP7)
Transporters [BR:gga02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    426892 (AQP7)
SSDB
Motif
Pfam: MIP DUF3172
Other DBs
NCBI-GeneID: 426892
NCBI-ProteinID: XP_004937140
CGNC: 52924
Ensembl: ENSGALG00000018534
Position
Z
AA seq 314 aa
MCDGKLRTSSQSQRRVKFRLVSKSRLEPESKMLEKIQKMLTIRSNSVRELLAEALGMYIL
MVLGLSSVAQTVLGKGEFGQYLSINLGFGIGVTMGIHAAGGISGAHLNAAITLTHCMFGN
LPWRKLPVYLLGQFLGSFLAAATIFGLYYDALHDYTNGNFTVTGPTATASIFSTYPSPYM
SLTGGFFTEFIATVMLLLGILVIHDEKNNGALKGTHALLTGILVLGIGMGMGMNTGYAIN
PSRDLPPRIFTAIAGWGVDVFRAGNYWWWVPVVAPTLGSLAGGLIHKLLIDIHNQPVLER
GNEKGQTVVESSTL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgtgtgatggaaaacttcgtacttcttcacagagccaacgtcgagtgaagtttcggctg
gtgagtaagtcaaggctggagccagagagcaaaatgctggagaagattcagaagatgctg
acaatccgtagcaactccgtcagggagctgctggcagaagcactggggatgtacatactg
atggtcttgggcttatcctctgtggcacaaacagtattaggaaaaggagaatttgggcag
tatctgagcatcaatttgggatttggcattggcgtcaccatggggatccatgcagctgga
ggcatctctggagctcatctgaatgctgccatcacactcactcattgcatgtttggaaac
ctcccctggagaaaacttccagtttatctgcttggccagttcctgggctcctttctggca
gcagccaccatctttggactctactatgatgcactgcatgactacaccaacgggaatttt
acggtgacaggaccaactgccacagcatcgatcttctccacttacccttctccctatatg
tccttaacggggggctttttcacagagtttatagcaacggtgatgttgctcttgggcatt
ttggtcatccatgatgagaaaaataacggagccctgaaaggcacacatgctctgctcacg
ggtatcctggttctgggcattggtatgggaatggggatgaatacaggctatgccataaac
ccctcccgggacctgccaccaagaatcttcacagcaattgctggctggggagtagatgtc
ttcagggctggaaattactggtggtgggtgccagtcgtagctccgacactgggaagtctt
gcaggtggtttaatccacaaactcttgattgatattcacaatcaacctgtcctggagcgt
ggaaatgagaaaggtcagacagtcgttgagagttccacgttgtga

DBGET integrated database retrieval system