KEGG   Gallus gallus (chicken): 426896
Entry
426896            CDS       T01006                                 

Gene name
KRT8
Definition
(RefSeq) keratin, type II cytoskeletal 8
  KO
K07605  type II keratin, basic
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    426896 (KRT8)
   04147 Exosome [BR:gga04147]
    426896 (KRT8)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     426896 (KRT8)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   426896 (KRT8)
  Exosomal proteins of other body fluids (saliva and urine)
   426896 (KRT8)
  Exosomal proteins of colorectal cancer cells
   426896 (KRT8)
  Exosomal proteins of bladder cancer cells
   426896 (KRT8)
SSDB
Motif
Pfam: Filament Keratin_2_head CENP-F_leu_zip TPR_MLP1_2 AlaDh_PNT_C Spc7 Ribosomal_S30AE ATG16 CRR7 TraC Baculo_PEP_C DUF745
Other DBs
NCBI-GeneID: 426896
NCBI-ProteinID: XP_015128103
CGNC: 52926
Position
33
AA seq 476 aa
MSVTITRKSVRSSSAVPVRSFSSRSFTAGPTVRMSAASAYGTLSGSRFGVGGLQRGPVAV
SGGGIAAVTVNQSLLTPLNLDIDTSIQQVRKEEKEQIKTLNNRFASFIDKVRFLEQQNKM
LETKWSLLQSQQPQRSDLRGLFEGYVGTLRRQLEGLGQERLRLEAELGSMQGLVEDFKNK
YEEEINHRTEKENEFVLLKKDVDEAYMSKVELESRLESLTDEINFLRQLYDEELREMQSQ
ISDTSVVLSMDNNRSLDLDSIIAEVKAQYEDIANRSRLEAETWYQSKYEELKTTAGKHGD
DLRTTRSEISELNRMIQRIQAEIEVLKNQRATLETAIAEAEERGEMALKDARAKLSELEA
ALQKAKQDLARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNLSIHTRTTGY
SGGFGGGFGSSFSTGYTVTPPALESAAVPKSRAIVIKKIETRDGKLVSECADVLTN
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgtctgtcaccatcaccaggaaatctgtgcggagcagctcggcggtcccggtccgatcc
ttcagctcccgttccttcaccgccggccccaccgtgaggatgagcgcggcctcagcctac
ggcaccctcagcgggagccgttttggggtcggggggctgcagcggggccccgtggccgtg
tcagggggtggcatcgcggctgtcaccgtcaaccagagcctcctgacccccctcaacctg
gatatcgacaccagcatccagcaggtgcgcaaggaggagaaggagcagatcaagaccctc
aacaaccgctttgcttccttcatcgacaaggtccggttcctggagcagcagaacaagatg
ttggagaccaaatggagcctcctgcagtctcagcagccacagcgcagcgacctgcggggg
ctcttcgagggctacgtggggaccctgaggaggcagctggaggggctgggccaggaacgg
ctgcggctggaggctgagctgggcagcatgcaggggctggtggaggacttcaagaacaag
tatgaggaggagatcaaccaccgcactgagaaggaaaatgagtttgtgctgctgaaaaag
gatgtggacgaagcatatatgagcaaagtggagctggagtcacggctggagagtctgacg
gatgagatcaacttcctgcggcagctctacgatgaggagctgcgggagatgcagtcgcag
atctccgacacctccgtggtgctgtccatggacaacaaccgcagcctggacctggacagc
atcattgcggaggtgaaggcgcagtatgaggacatcgccaaccgcagcaggctggaggct
gagacctggtaccagagcaagtatgaggagctgaagacgacggccggcaaacacggcgac
gacctgcgcaccacccgcagcgagatcagcgagctcaaccggatgatccagaggattcag
gccgagatcgaggtgctcaagaaccagcgagccaccctggagacagccattgcagaggca
gaggagcggggggagatggctctgaaggacgccagagccaaactgtctgaactggaggca
gctctgcagaaggcgaagcaggacctggcccggcagctgcgtgagtaccaggagctgatg
aacgtcaagctggccctggacatcgagattgcgacctacaggaagctgctggagggcgag
gagagcaggttggagtcaggaatgcagaacctcagcatccacacccggaccacggggtac
tcaggaggatttggggggggctttgggagctccttctccacaggttacaccgtgaccccc
cccgcgctggagagtgctgctgtccccaaatctcgtgccatcgtcatcaagaagattgag
acccgcgatggcaagctggtgtctgagtgcgccgatgtcctcaccaactga

DBGET integrated database retrieval system