KEGG   Gallus gallus (chicken): 426906Help
Entry
426906            CDS       T01006                                 

Gene name
COPA
Definition
(RefSeq) coatomer subunit alpha
  KO
K05236  coatomer subunit alpha
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    426906 (COPA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    426906 (COPA)
Membrane trafficking [BR:gga04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    426906 (COPA)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   426906 (COPA)
  Exosomal proteins of bladder cancer cells
   426906 (COPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COPI_C Coatomer_WDAD WD40 ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 426906
NCBI-ProteinID: NP_001026576
CGNC: 6964
Ensembl: ENSGALG00000009153
UniProt: Q5F354
Position
25
AA seq 1224 aa AA seqDB search
MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH
KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW
NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD
VRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAW
EVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAH
PNLNLFAAGHDGGMIVFKLERERPAYAVHGNMLYYVKDRFLRQLDFNSSKDVAVMQLRSG
SKFPVFNMSYNPAENAVLLCTRASNLENSTYDLYTIPKDADSQNPDAPEGKRSSGLTAVW
VARNRFAVLDRMHSILIKNLKNEITKKVQVPNCDEIFYAGTGNLLLRDADSITLFDVQQK
RTLASVKISKVKYVIWSADMSHVALLAKHAIMICNRKLESLCNIHENIRVKSSAWDESGV
FIYTTSNHIKYAVTTGDHGIIRTLDLPIYVTRVKGNNVYCLDRECRPRVLTIDPTEFKFK
LALINRKYDEVLHMVRNAKLVGQSIIAYLQKKGYPEVALHFVKDEKTRFSLALECGNIEI
ALEAAKALDDKNCWEKLGEVALLQGNHQIVEMCYQRTKNFDRLSFLYLITGNLEKLRKMM
KIAEIRKDMSGHYQNALYLGDVAERVRILRNCGQKSLAYLTAATHGLDEEAENLKETFDP
EKETIPDIDPNAKLLQPPAPVMPLDTNWPLLTVSKGFFEGTIASKGKGGALAADIDIDNV
GTEGWGEDAELQLDEDGFVDAGEGFGEEGLGKGQEEGGGWEVEEDLDLPPELDVPAGPAG
GAEDGFFVPPTKGTSPAQVWCNNSQLPVDHILAGSFETAMRLLHDQVGVTNFGPYKQLFL
QTYARGRTTYQALPCLPTMYGYPHRNWKEAGLKNALPAVGLKLNDLIQRLQLCYQLTTAG
KFEEAVEKFRSILLSVPLLVVDNKQEIAEAQQLIAICREYIVGLSMEIERKKLPKETLEH
QKRICEMAAYFTHSNLQPVHMILVLRTALNLFFKLKNFKTAATFARRLLELGPKPEVAQQ
TRKILSACEKNPTDTYQLNYDMHNPFDICAASYRPIYRGKPVEKCPLSGACYCPEFQGQI
CRVTTVTEIGKDVIGLRISPLQFR
NT seq 3675 nt NT seq  +upstreamnt  +downstreamnt
atgctgactaagttcgagaccaaatcggctcgggtgaaagggctcagcttccaccctaag
cggccgtggatcctcaccagcctacataatggcgtcatccagctgtgggactatcgtatg
tgcacccttatcgacaagttcgacgagcacgatggacctgttcgaggtattgatttccac
aagcagcagcctctgtttgtttctggaggtgatgactataaaataaaggtctggaattac
aaactacgccgctgtcttttcactctgcttgggcatttggactacatccgcaccaccttc
ttccatcatgaatatccgtggatcttgagtgcttctgatgatcagaccattcgggtttgg
aactggcagtccagaacttgtgtctgtgtgctgacaggacacaaccactatgtgatgtgt
gcccagtttcacccctctgaggacctggtagtatcagccagcttggatcagactgtacgc
gtttgggatatttctggcttaaggaagaagaacctctcccctggagctgtggagtcggat
gtcaggggaataactggggtggatttgtttgggacaacagatgcagttgtgaagcacgtt
cttgagggccacgatcgtggagtgaactgggctgccttccatcccacaatgccactgatt
gtgtcaggagctgatgatcgacaagtgaagatctggaggatgaacgaatcaaaggcctgg
gaggttgacacttgccgggggcattacaacaatgtctcgtgtgctgtctttcaccctcgg
caggagctcatcctcagcaattcagaagacaaaagcatccgtgtctgggatatgtcaaaa
cgcacgggtgtccagaccttccgccgtgatcatgatcgtttttgggtattggctgctcat
cccaatctcaacctctttgctgcaggccatgatggtggcatgattgtcttcaaactggaa
cgtgagcgtcctgcttatgcagtacatgggaatatgctgtattatgtaaaggaccgattc
ctccgccaacttgactttaacagctcaaaagacgttgctgttatgcagctgcgcagtggt
tccaagttccctgtgttcaacatgtcgtacaacccagctgagaatgctgtccttctctgc
actagagcaagcaacctggagaatagcacttatgacctatacaccattcccaaggatgca
gactcccagaatccagatgcccctgaagggaagcgttcctccgggctaacagctgtgtgg
gtagctcgtaaccgctttgcagtcctggatcgcatgcattcgatcctcatcaaaaacttg
aagaatgagatcacaaagaaggttcaggtgccgaactgtgatgagattttctatgctggc
acagggaacctgttactgagagatgcagactccatcaccctctttgacgtgcagcagaag
cggactctggcctcagtgaagatctccaaggtgaaatatgtcatctggtcagctgacatg
tcccatgtagctctgttggctaagcatgccatcatgatctgcaacagaaagctggaatcg
ctgtgtaacatccatgaaaatatccgtgtcaagagtagtgcctgggatgaaagtggtgtt
ttcatctataccaccagcaaccacatcaaatacgctgtcaccacaggggaccatggcatc
atccgcaccctggacctgcctatctatgttactcgtgtgaaggggaacaatgtgtactgc
ctggacagagaatgtcgccccagggtccttaccattgatcccacagagttcaaattcaag
ctggcattgatcaacagaaagtatgatgaggtgctgcacatggtgaggaatgctaagctt
gtgggccagtccatcattgcttacctgcagaaaaagggttaccctgaggtggccctgcac
tttgttaaggatgagaagacccgtttcagtctggcactggagtgtggcaacattgagatt
gccctggaagcagccaaggctctggatgacaagaattgctgggagaaactgggagaagtg
gcactactgcaaggaaatcaccagattgtggagatgtgctaccagcgcaccaagaacttt
gataggctctccttcctctatcttattactggcaacctggagaagcttcggaagatgatg
aagatagctgagatccgtaaagatatgagtggccactaccagaatgccttgtatctagga
gatgtggcagagagagtgaggatcctgaggaactgtggacaaaagtctctggcctatctc
acagctgcaactcatggtctggatgaggaagctgaaaacctgaaggaaacatttgatcct
gaaaaggaaacgattccagacattgatcccaatgcaaaactactgcagcctcctgctcct
gtcatgcccctagataccaactggccattgctgactgtctccaaggggttctttgaagga
acaattgctagcaaaggcaaagggggtgccttggctgctgacatagatattgacaatgtc
ggtactgaaggctggggagaagatgcagaattacagcttgatgaagatggctttgtagat
gctggagaaggctttggagaggaaggtctgggtaaaggacaggaagaaggaggtggatgg
gaagttgaagaagatttggatcttcctcctgaactggatgttcctgctggtccagcagga
ggagcagaagatggcttctttgtgccacccaccaagggcaccagcccggctcaggtatgg
tgtaacaattcacagcttcctgttgaccacattctggcaggttcctttgagacagcaatg
agactcctccatgatcaggtgggagtaactaactttggaccctacaagcagctgttcctg
cagacctatgcccgtggccgtacaacctaccaagccctgccatgtctccctaccatgtat
ggctacccacatcgcaactggaaagaagctggcttgaagaatgccctcccagctgttggg
ctgaagcttaatgacctgatccagcgcttgcagctgtgctaccagctcacaacagctggc
aagtttgaggaggctgtggagaagttccgctccatcttgctgagtgtgcccttgctggtg
gtggacaataagcaggagattgctgaggcccagcagctgatagccatctgtcgggagtac
attgtaggactctcaatggagatcgagcggaagaagctgcccaaggagaccctggagcac
cagaagcgaatctgtgagatggctgcctatttcacccactccaacctgcagcctgtccac
atgatcttggtactgcgcactgctctcaacctcttcttcaaactcaaaaacttcaagaca
gctgctacttttgctcgtcggctgctggagctgggtccaaagcctgaggtggcccagcag
acccgcaagatactgtcagcatgtgagaagaatcccactgacacctaccagctcaactat
gacatgcacaacccctttgacatctgtgctgcctcctaccgacccatctatcgtggcaag
cctgtggagaagtgtccactcagtggagcttgctattgccctgagttccaggggcagatt
tgccgtgtcacaacagtgacagagattggcaaagatgtcattgggctgcggatcagcccc
ctccaattccgctga

DBGET integrated database retrieval system