KEGG   Gallus gallus (chicken): 426948
Entry
426948            CDS       T01006                                 

Gene name
LZTS3
Definition
(RefSeq) LOW QUALITY PROTEIN: leucine zipper putative tumor suppressor 3
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Fez1 ATG16 PKcGMP_CC CALCOCO1 FAM184
Other DBs
NCBI-GeneID: 426948
NCBI-ProteinID: XP_420876
CGNC: 52942
Position
4
AA seq 663 aa
MATLETLPVLSDSTYPNPENFHGFAPRPSQNTSRGIMGSVGSGVANDQEFAMKSVGTRTQ
SSGRQMEGSRNGYSTREISNRYSGEEKTYKSEKVSNSLYINGDLRKSEKVKMDICGNVTT
NNEKNMPPPPQYREPSNPPKILPISGKLEQSNEPLVRPSAFKPVVPKNFHSMQNLCPPQS
NGVTENRKSLNHANSNSPSAPKSGLDKSSLNRTTNQVGGLSDSGRNSLTSLPTYGTGYSQ
HVGPMSASTSHINRIGTTYTDKNIVGYNGISTSDSGRSSSKSTSSFNRLNHLNETMPFHS
PSTDDIIQDLEDRLWEKEQEVLQMRRNLDKSEAAIFQVFEEKQKIWEREMEDLRXNYANK
LQQVSKKAQRAQQALQLQIFKLQQEKKKLQDDMGQLLQQREELEKKFVAFKKEQAEFLPK
IEETKWEVCQKAGEISLLKQQLKDSQADVSQKLNEIVGLRTQLKEGKNFLREKEEQILTL
KDSYSSKSVNLEICESELQRKMSEVQVLREKLNHCELEVSGLKRTLASMGPPGPFGGDLA
EKLRDPLACESDEAKMQRQSEDSVNALRKEVERLQTELKLERQQREQQVMDFEEERRTWQ
EEKEKVIKYQKQLQLNYVEMYQKNQLLEHKVNEMNTKATSPPHTEEKKPWTPSRLERIES
TEI
NT seq 1992 nt   +upstreamnt  +downstreamnt
atggccacgctagagacgctgccagttcttagtgactcaacgtaccccaatccagaaaac
ttccacggatttgctcctcggccatcccaaaacacgtcccgcggcatcatggggagcgtg
gggagcggagtggccaacgaccaggagtttgccatgaagagtgtggggaccaggacgcag
agcagcggccggcagatggaggggtctcgcaatgggtactccacacgggagatctccaac
cgctactccggcgaggagaagacgtacaagtcggagaaggtctccaattccctctacatc
aatggcgacctgcgtaagagtgagaaggtgaagatggacatctgtgggaatgtgaccacc
aacaatgagaagaacatgccacctcctccccagtaccgagagcccagtaacccaccaaag
atattgccaatctccggcaaactagagcagagcaatgagcccttagttagaccctcagcc
tttaaaccagtagttcctaaaaacttccattccatgcagaacctctgcccgccgcagagc
aacggggtgacagagaacagaaagagcttgaaccatgccaacagcaatagcccatctgca
cccaaaagcggactcgacaagagcagccttaacaggactacaaaccaagtgggaggcctt
tcggattcgggccgtaactcgttaacgagtctgcccacgtacgggacaggctacagccag
catgtgggcccgatgagcgcctcgacgagccacatcaaccgcatcggcacgacctacacg
gacaagaacatcgtgggatacaacgggatatctacctcagacagcggccggtcctcgagc
aagagcacctcttcattcaacagactgaaccatctcaacgaaacgatgcctttccactct
ccttcgacagacgacatcatccaagacttggaggacaggctgtgggagaaggagcaggag
gtcctccagatgagaaggaacttggacaaaagcgaggcagccatcttccaagtgtttgag
gagaagcagaagatctgggagcgggaaatggaggatctcaggncaaactacgccaacaaa
ttgcagcaggtgtccaaaaaggcgcagcgggcacaacaggccttgcagctccagatcttc
aagctgcagcaggagaaaaaaaaactccaagatgacatggggcaactcctccagcagcga
gaggagctggagaagaaattcgtggctttcaagaaggagcaggctgagtttctcccaaag
attgaagagaccaagtgggaggtgtgccagaaggcaggtgagatctccctgcttaagcag
cagctgaaggattcccaagcggacgtctcccagaagctgaacgagattgtggggctgcgg
acacagctcaaggaaggtaagaacttcctccgggagaaggaggaacagatcctcaccttg
aaagactcctacagctccaagagtgtcaacctggagatctgcgagagcgagctgcagcgg
aaaatgagcgaggtccaggtgctgagggaaaaactgaaccactgtgagctggaggtctca
ggactgaagcggacacttgccagcatgggacctccggggccttttggtggggacctggct
gagaagctgagggacccgctggcctgcgaaagcgacgaagccaagatgcagaggcagagc
gaggacagcgtcaatgcgctgcggaaggaggtggagcggctgcagacggagctgaagctg
gagcggcagcaacgggagcagcaggtgatggacttcgaggaggagcggcgcacgtggcaa
gaagagaaggagaaagtcatcaagtaccagaagcagctgcagctgaactacgtggagatg
taccagaagaaccaactcttggagcacaaggtgaacgagatgaacacaaaggccaccagc
ccaccgcacaccgaggagaaaaaaccatggactccctccaggctggagagaatagagtcc
actgagatctga

DBGET integrated database retrieval system