KEGG   Gallus gallus (chicken): 427122
Entry
427122            CDS       T01006                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    427122 (ERAP1)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     427122 (ERAP1)
Peptidases and inhibitors [BR:gga01002]
 Metallo peptidases
  Family M1
   427122 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N BLOC1_2
Other DBs
NCBI-GeneID: 427122
NCBI-ProteinID: XP_001232418
CGNC: 52992
Ensembl: ENSGALG00000014684
UniProt: A0A1L1RVF4
Position
Z
AA seq 929 aa
MAAPRWEVVVLGLASVAWCVGDAQSGGGSAQFPWDKVRLPKHVVPLHYHLLIHPNLTTLT
FTGTVAIDIAVTQPTNAVVLHSKRLRVTKAAIEAGAGSTCAVREVRVLQHPAHEQLALLA
AEPLCTGHNYTISIQYAANLSDSFHGFYKSTYRTQEGELRVLASTHFEPTSARMAFPCFD
EPAFKAMFSVKIRREPYHLALSNMPLVKSVNIASWLVEDHFDTTVKMSTYLVAFIVSDFK
SISKVTSHGVKISIYTVPEKINQAHYALDAAVKLLDFYEDYFSIPYPLPKQDLAAIPDFQ
SGAMENWGLTTYRESALLYDPEKSSVSSRLWITMVIAHELAHQWFGNLVTMEWWNDLWLN
EGFAKFMELLSVNVTHPELTVEDYFLRRCFDAMEVDALNSSHPVSTPVEDPAQILEMFDE
VSYEKGSCILNMLRDFLTADVFKAGLVQYLQKYSYQNTKNEDLWESLANICPTVGTEKSE
LQSDGFCRRNQQSSSNAHWTKETLDVKAMMDTWTLQKGFPLVTVTVRGKNVHLQQEHYKK
GEDSLSPTENGYLWHIPLTYITSKSYTVERFLMRTKTDVIILPEEVEWIKFNVDMNGYYI
VHYEDDGWDRLINLLRENHTVVSSNDRASLINNIFQLVRIKKLSISKAFDLTSYMKRETQ
IMPILQGMNELVPIYKLMERRDMDDTEKQLKDYIVSLFKDLIDKQLWSDEGSVSERMLRQ
SLLMFACVRRYQPCVDKAEEYFSKWQKSNGTLRLPADVKTAVYTVGAQTSEGWDFLLSKY
QHHSFSVDKDKIASALSLTRNKEKLQWLMDEGLRGDIIKTQDFPYIIVSVARNPSGYHLA
WTFLKENWEKLIEKFELGSSSIAGIVTGVTNQYSTRPQLAQVKEFFSSLEEKSAQLRCIQ
QAIETIEDNIQWMDRYFEEIKTWLQKNHS
NT seq 2790 nt   +upstreamnt  +downstreamnt
atggcagcgccgcgctgggaggtggtggtgctggggctggcgagcgtggcgtggtgcgtc
ggcgatgcccagagcggtggaggcagcgcgcagtttccctgggacaaggtgaggctcccc
aagcacgttgtcccgctgcactaccacctcctcatccatcccaacctcaccacgctcacc
ttcaccggcaccgtggccatcgacatcgcggtcacgcagccaacgaacgcggtcgtccta
catagcaaacgcctgcgcgtcaccaaggctgccatcgaggcgggggccgggagcacctgc
gccgtgcgggaggtgagggtgctgcagcacccggcccacgagcagctggcactgctggcc
gccgagccgctgtgcaccgggcacaactacaccatcagcatccagtacgcagccaacctc
tccgattccttccacggcttctacaaaagcacctacagaacccaggaaggagaactcaga
gtgcttgcatcaactcattttgagccaacatctgcaagaatggccttcccctgttttgat
gagccagccttcaaagccatgttttcagttaagattaggagggaaccatatcaccttgcg
ttgtccaatatgcctctggtgaagtctgtaaacatagcttcatggcttgttgaagaccat
tttgataccactgtcaagatgagtacttaccttgtggcctttatcgtttcggattttaag
tccatcagcaaagtaaccagtcatggagttaagatttccatatacacagtaccagaaaag
atcaaccaggctcattatgcactggatgcagcagtaaaacttctagacttttatgaggac
tacttcagcattccctaccccttaccaaaacaagatttagcagctattcctgattttcag
tctggtgctatggaaaactgggggttgaccacatatcgggaatctgcgttgctgtacgat
cctgagaagtcctcagtttcctctaggctttggattactatggtaatagcccatgagctg
gctcaccagtggtttggcaacctcgttaccatggagtggtggaatgatctatggttaaat
gaagggtttgcaaagtttatggagctcctgtcggtaaatgttacccatccagaactgaca
gttgaagattatttcttgagaagatgtttcgatgccatggaagtggatgcgttaaattca
tcccatcctgtgtctactcctgtggaggatccggctcagattttagaaatgttcgacgaa
gtttcatatgagaagggatcatgtatattaaatatgctgagggacttcctgactgcggat
gtgtttaaggctggacttgtgcagtacctacagaaatacagctatcagaacactaagaat
gaagatttgtgggaaagtttggcgaatatttgtcccacagtaggtactgaaaaaagtgaa
ctacagagtgacggcttttgcagaagaaaccaacagtcatcttcaaatgcacactggacc
aaagagactctagatgtgaaggcaatgatggacacttggacactgcaaaaaggttttccc
ctggtaactgtcacagtgagaggaaagaatgtccacctgcagcaggagcactacaagaaa
ggagaagattctctttcacccacagaaaatgggtacttgtggcacattcccctaacctac
attaccagcaaatcctacaccgttgaaagatttttgatgagaaccaaaacagatgtcatt
atccttccagaagaagttgaatggattaaattcaacgtggacatgaatggttattacatt
gtgcactacgaagatgacggatgggatcgtctgatcaaccttttgagagagaaccataca
gtggttagcagcaatgacagagcaagtctcattaacaatatattccagctcgtgagaata
aaaaaactgtcgatttctaaagcttttgatttaacttcgtacatgaaacgggaaacacag
atcatgcccatactccaaggtatgaatgagctggttcctatatacaagctcatggagcgg
agagatatggatgacacagaaaaacagttaaaggactatatagtcagtctatttaaggac
ctaattgacaagcagctttggagtgatgaaggctcggtgtccgagagaatgcttcggcag
tccctgctgatgtttgcatgtgtgcgcaggtaccagccctgcgtggacaaagcagaagag
tatttttcaaaatggcagaaatccaatggaaccttaaggctgccagcagatgtgaagaca
gcagtgtataccgttggagcacaaacatctgaaggatgggatttcctccttagtaaatac
cagcaccactccttcagtgtagacaaagataaaattgcatcagctctcagcctcaccagg
aataaggagaaacttcagtggctaatggatgaaggtctgcgtggtgacatcataaaaact
caggattttccatacattattgtgtctgttgccagaaatccatctggctatcatctcgct
tggaccttcttaaaggagaactgggagaaactcatcgaaaaatttgaactcggttcatca
tccatagcaggcattgtcactggagtgacaaatcagtactcaacaaggccacagcttgcg
caggtaaaagaattcttcagttctttggaggaaaaaagtgcacagcttcgttgcatccag
caagccattgaaactatcgaggacaacatacaatggatggatagatattttgaggaaatc
aaaacatggctgcaaaagaaccactcataa

DBGET integrated database retrieval system