KEGG   Gallus gallus (chicken): 427232
Entry
427232            CDS       T01006                                 

Symbol
HACD4
Name
(RefSeq) very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4
  KO
K10703  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [EC:4.2.1.134]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00062  Fatty acid elongation
gga01040  Biosynthesis of unsaturated fatty acids
gga01100  Metabolic pathways
gga01212  Fatty acid metabolism
Module
gga_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    427232 (HACD4)
   01040 Biosynthesis of unsaturated fatty acids
    427232 (HACD4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gga01004]
    427232 (HACD4)
Enzymes [BR:gga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.134  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
     427232 (HACD4)
Lipid biosynthesis proteins [BR:gga01004]
 Fatty acid synthase
  Component type
   427232 (HACD4)
SSDB
Motif
Pfam: PTPLA
Other DBs
NCBI-GeneID: 427232
NCBI-ProteinID: XP_424816
CGNC: 66520
Ensembl: ENSGALG00000028142
UniProt: R4GIV6
Position
Z:complement(34261358..34278157)
AA seq 246 aa
MKPHFEIRTTPSLGENQHMRDRSSSFTVKTYLFVYDLMQFCGHSWIFTNMIIRYMSFGKD
SLADTFYSIGLVMRLCQLLSVLEILHILIGIDKSRLLPRFLQITERIVVLFVVINSQEEV
QGKYIVCVLFFLWNLLDVVRYTYNMLARMGIHYLPLTWLNFSLCILLYPLSVLAKAFAIC
VSLPYFETFGTYSVKLPFPFAFSVYFPYVLKMYLLVLFTGMCFIIRNLFSERKAHLETGN
SKKKSS
NT seq 741 nt   +upstreamnt  +downstreamnt
atgaaaccccattttgagatcaggaccactccatcactcggagagaatcaacacatgaga
gatcggtcctccagctttaccgtgaagacctacctgtttgtgtatgacctgatgcaattc
tgtgggcattcctggatatttacaaatatgatcatcaggtacatgtcgtttggaaaagat
tcattggccgacacattttactccataggacttgtgatgcgcctttgtcagttgttatct
gtactggagatcctacacatcctcattggcattgataaaagccgtctcttgcccaggttt
ttgcagatcactgagagaatagttgtgttgtttgtcgtgatcaacagtcaggaagaagtt
caagggaaatacattgtgtgtgttctatttttcctttggaacttattagatgtggtcagg
tacacttacaacatgttggcaaggatgggaattcactacttaccactgacatggctgaac
ttctcactgtgcatcctgctctatccgctttcagttctggctaaagcatttgcaatctgt
gtatcactgccttactttgaaacctttggcacatactccgtcaagctaccatttccattt
gccttctcagtctacttcccctatgttctgaaaatgtacctgctagtgctgtttacaggt
atgtgctttatcatccggaacctcttctcagaaaggaaggctcacctagaaacaggcaac
tccaaaaagaaaagcagctaa

DBGET integrated database retrieval system