KEGG   Gallus gallus (chicken): 427234
Entry
427234            CDS       T01006                                 

Gene name
MLLT3
Definition
(RefSeq) protein AF-9 isoform X2
  KO
K15187  YEATS domain-containing protein 1/3
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gga03021]
    427234 (MLLT3)
   03036 Chromosome and associated proteins [BR:gga03036]
    427234 (MLLT3)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     427234 (MLLT3)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    Dot1-containing complex
     427234 (MLLT3)
SSDB
Motif
Pfam: AHD YEATS BET
Other DBs
NCBI-GeneID: 427234
NCBI-ProteinID: XP_004949187
CGNC: 11217
Ensembl: ENSGALG00000015078
UniProt: A0A1D5PVW7
Position
Z
AA seq 530 aa
MAGACAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFP
RPKRVCKDPPYKVEESGYAGFILPIEVYFKNKIMVMTDGTSFSSGQSLHLPNLPSNSLSF
SEVKKKSSHGPKDPTKILNINSSSGSTNSFSKPHKLTKEHKEKTSKDSKEQKSAFKEPSR
EHNKSSKESSKKPKENKPLKDEKLVPKMAFKEPKSMSKEPKSENTPILTITGGQQQEKKT
PIKRPSVLDSDEPSAKKRKKNVSESLFKSFPNAPSLVLTCSADKKQTKDRSQLKMGRVKI
ESDTLEKKTSTLPPFDDIIDPNDSDVEENMSSKSESDQPSPASSSSSSSSSFTPSQNSRQ
QGPLRSIMKDLHSDDNEDESEEPDDNDNDSELERPVNTRGGSRSRRVSLSDGSDSDSNSA
SSPPRHEPAPPLLKTNSNQILEVKSPIKQNKSDKQIKNGDCDKAYLDELVELHRRLMTLR
ERHVLQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggccggcgcgtgcgccgttcaggtgaagctggagctggggcaccgagcccaggtcagg
aagaaacccaccgtggagggcttcacccacgactggatggtgttcgtccgcgggcccgag
cacagcaacatccagcacttcgtggagaaggtcgtcttccacctgcacgagagcttcccc
aggcccaagagagtgtgcaaggatccaccctacaaagttgaagaatctggttatgctggt
ttcattttgccaattgaggtttacttcaaaaataagattatggttatgacagatggcaca
tcattctcttcagggcagagccttcatctccccaaccttcctagtaactccctgtctttt
tctgaagtgaagaagaaatcatctcatgggccaaaggacccaactaagattctgaacata
aatagcagtagtggcagtactaacagtttttcgaagccccacaagttaacaaaggagcac
aaagaaaaaacttctaaagactcgaaagaacaaaaaagtgccttcaaagaaccttccagg
gaacacaacaaatcttccaaagaatcctctaagaaacccaaagaaaataaaccactgaaa
gatgaaaaattggttcctaagatggccttcaaggagcctaaatccatgtccaaggagcca
aaatctgaaaacacccccatccttaccattacaggtggacagcagcaagaaaagaagacc
cctataaaaaggccctctgttctggattctgatgaaccttctgcaaaaaagagaaaaaag
aatgtgtcagagtcattatttaaaagctttcctaatgctccatcgctagttcttacttgt
tcagctgacaaaaaacaaacaaaggacaggtctcagctcaagatggggagagtcaaaatt
gaaagtgatacactggaaaagaagacatctactctgccaccatttgatgatattatagac
cccaatgattctgacgtggaggaaaacatgtcttctaaatctgaatctgaccagcccagt
cctgccagttccagctccagttccagttccagttttacaccatctcaaaacagccgacaa
caaggtccattgaggtctataatgaaagatctgcattcggatgataatgaagatgaatca
gaggaaccagatgacaacgataacgattctgagttggaacggcctgtaaatacacgagga
ggaagcaggagtcgcagggttagtctgagcgatggaagtgacagtgacagcaattcagct
tcctcaccaccacgtcatgaaccagcaccacctttattaaaaactaacagcaaccagatt
ctagaagtgaaaagtccaataaagcaaaacaaatctgataaacagataaagaatggtgat
tgtgataaggcgtatctcgatgaactagtagagctccacagaagattaatgacattgaga
gagagacatgtgctgcagcagatagtaaatcttatagaggaaactggacactttcatatc
acaaatacaacctttgactttgatctttgctcactggacaaaaccacagtccgaaaacta
cagagttatctggaaacatctggaacctcctga

DBGET integrated database retrieval system