KEGG   Gallus gallus (chicken): 427235
Entry
427235            CDS       T01006                                 

Gene name
ACER2
Definition
(RefSeq) alkaline ceramidase 2
  KO
K01441  alkaline ceramidase [EC:3.5.1.23]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00600  Sphingolipid metabolism
gga01100  Metabolic pathways
Module
gga_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    427235 (ACER2)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.23  ceramidase
     427235 (ACER2)
SSDB
Motif
Pfam: Ceramidase
Other DBs
NCBI-GeneID: 427235
NCBI-ProteinID: XP_424820
CGNC: 11220
Ensembl: ENSGALG00000015081
UniProt: E1C990
Position
Z
AA seq 275 aa
MGAMLWWDQLRAGSSEVDWCEDNYTIVPAIAEFYNTISNVLFFVLPPICMCLFRQYATCF
NSGIYLIWTLLVVVGIGSVYFHATLSFLGQMLDELAILWVLMCALAMWFPRRYLPRVFRN
DRSRFKAAVGVLSGVTTCLAFIKPAINNISLMTLGVPCTALLIAELKRCENLRVYKLGLF
SGLWWMLALFCWISDKAFCEIWSSFNFPYLHCVWHILICLAAYLGCVCFAYFDAASEIPE
QGPVIKFWPSERWAFIGVPYVTLLCAHKKSPVKIT
NT seq 828 nt   +upstreamnt  +downstreamnt
atgggcgcgatgctgtggtgggatcagctgcgggccggcagctccgaggtggactggtgc
gaggacaactacaccatcgtgcccgccatcgccgagttctacaacacgataagcaacgtc
ttattttttgttttaccacccatatgtatgtgcttattccgtcaatacgcaacctgcttc
aacagcggaatatatttaatatggactctactagttgtggtcggaattggatctgtttac
tttcatgccaccctcagcttcctgggtcagatgctggatgagctggctattctctgggtc
cttatgtgtgctcttgccatgtggttccctaggagatatctaccaagagtttttcgaaat
gacaggagccggtttaaagctgctgttggtgtcctgtctggagttactacctgccttgcc
ttcattaaacctgccatcaacaacatctcactaatgactctgggtgttccttgcacagct
ttactcattgctgagttgaagaggtgtgaaaacctgcgtgtgtacaagcttggtctgttt
tcaggtctttggtggatgctagcacttttctgctggatcagtgacaaagctttttgtgag
atctggtcatcatttaacttcccctatttgcactgtgtatggcacattttgatttgcctt
gcggcttacctaggctgtgtctgtttcgcttacttcgatgctgcctctgagatccctgag
cagggccccgtcataaagttctggccaagtgagagatgggcattcattggcgttccctac
gtcaccctcctctgtgcacacaagaaatcaccggtgaagatcacatga

DBGET integrated database retrieval system