KEGG   Gallus gallus (chicken): 427276Help
Entry
427276            CDS       T01006                                 

Gene name
PPIP5K2
Definition
(RefSeq) inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 isoform X1
  KO
K13024  inositol-hexakisphosphate/diphosphoinositol-pentakisphosphate 1-kinase [EC:2.7.4.24]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    427276 (PPIP5K2)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.24  diphosphoinositol-pentakisphosphate kinase
     427276 (PPIP5K2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 PPIP5K2_N RimK
Motif
Other DBs
NCBI-GeneID: 427276
NCBI-ProteinID: XP_004949357
CGNC: 11360
Ensembl: ENSGALG00000015264
UniProt: F1NQL7
Position
Z
AA seq 1249 aa AA seqDB search
MSVSATESDPPRFFVGGEDGEELLDSARPTDYEHFYDHGEEEEEEYDSPPERQIAVGICS
MAKKSKSKPMKEILERLSMFKYITVVIFEEDVILNEPVENWPLCDCLISFHSKGFPLDKA
VAYAKLRNPFIINDLNMQYHIQDRREVYGILKAEGILLPRYAVLNRDPNNPQECNLIEGE
DHVEVNGEIFQKPFVEKPVSAEDHNVYIYYPTSAGGGSQRLFRKIGSRSSVYSPESSVRK
TGSYIYEEFMPTDGTDVKVYTVGPDYAHAEARKSPALDGKVERDSEGKEVRYPVILNARE
KLIAWKVCLAFKQTVCGFDLLRANGQSYVCDVNGFSFVKNSMKYYDDCAKILGNIIMREL
APQFQIPWSIPLEAEDIPIVPTTSGTMMELRCVIAVIRHGDRTPKQKMKMEVKHQKFFDL
FEKCDGYKSGKLKLKKPKQLQEVLDIARQLLVELGQNNDSEIEESKAKLEQLKTVLEMYG
HFSGINRKVQLTYLPHGCPKTSSEEEDNRRNEPSLLLVLKWGGELTPAGRVQAEELGRAF
RCMYPGGQGDYAGFPGCGLLRLHSTYRHDLKIYASDEGRVQMTAAAFAKGLLALEGELTP
ILVQMVKSANMNGLLDSDSDSLSSCQHRVKARLHEILQRDREFTADDYDKLTPSGSISLI
KSMQVIKNPVKTCDKVYSLIQSLTSQIRQKMEEPKSADIQLYHSETLELMLRRWAKLEKD
FKTKNGRYDISKIPDIYDCIKYDVQHNGSLKLENTMELYRLSKALADIVIPQEYGISKAE
KLEIAKGYCTPLVRKIRSDLQRTQDDDTVNKLHPLYSRGVMSPERHVRTRLYFTSESHVH
SLLSTLRYGALCDETKDEQWKRAMDYLNVVNELNYMTQIVIMLYEDPNKELSSEERFHVE
LHFSPGAKGCEEDKNLPSGYGYRPASRENEGSKKTSHRNDSDEEAHTSKRDETDRSVVMF
KPMVSDPIHIHRKSPLPRSRKIGSVEEESPLSVSSPECIGTWLHYTSGVGTGRRRRRSGE
QITSSPVSPKSLAFTSSIFGSWQQVLSESNSNLRTPRTILEQKQSGLGSHCAGLFSTSVL
GGSSSAPNLQDYARTHRKKLTSSGFVDDTTRGSAVKRFSISFARHPTNGFELYSMVPSIC
PLETLHNSLSLKQVDEFLASVAASSKENLQETSSPTYMSPLSGRKIPLNTYTPAKIQPTP
LETLPEKPAIEKPTSSSSESSVCVPDVKLSAEEASLDAELNSDTFSENK
NT seq 3750 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttagtgcaacagagagtgatcctcctagattctttgttggtggagaagatgga
gaagagctgttggattcagccagacctacggattatgaacatttctatgaccatggggaa
gaagaagaggaagaatatgactcgccaccagaaagacaaattgcagttgggatttgttca
atggccaagaaatcaaagtccaaaccgatgaaagaaattcttgaacgtctctccatgttt
aagtacattactgttgtaatatttgaggaggatgttattttgaatgagccagtagaaaac
tggccattatgtgactgtctcatttctttccattctaaaggatttccactggacaaagca
gttgcctatgcaaaactcaggaatccattcataatcaatgacttgaatatgcagtatcac
atacaagacaggagagaagtgtatggtattcttaaagctgaaggcattttacttcctcgt
tatgcagttctgaaccgtgatccaaacaatccacaagaatgcaacttgattgaaggagaa
gatcatgtggaagtgaatggggaaattttccaaaagccttttgtagaaaaaccagttagt
gctgaggaccacaatgtttacatttattacccaacatctgctgggggtggaagccagagg
ctttttcgaaagattggcagcagaagcagtgtttattcccctgaaagcagcgtgagaaaa
acaggctcctatatttatgaggaatttatgcctacggatggcacggatgtgaaggtgtac
acagtaggtcctgactatgctcatgctgaagcccggaagtccccagctcttgatggcaag
gtagagcgggatagcgaaggaaaagaagtgaggtatccagtcatcctgaatgcaagagag
aagttaattgcttggaaagtatgccttgcctttaagcaaacagtttgtggctttgacttg
ctgcgtgctaatggacagtcatatgtctgtgatgtgaacggcttcagttttgtgaaaaac
tccatgaaatactatgatgattgtgctaagatactgggaaatatcataatgagagaactt
gctccccagtttcagataccatggtcaattcctttggaagctgaagacatccctatcgtg
ccaaccacctctgggacaatgatggagcttagatgtgttatagctgtaatacgtcatgga
gaccgaacaccaaaacaaaaaatgaaaatggaagtaaaacatcaaaaattttttgatctc
tttgaaaaatgtgatggatataaatctggaaaactaaaactgaaaaagccaaaacaactg
caggaagtgcttgatatagcaaggcaactccttgtggaacttgggcagaacaatgattct
gaaattgaggaaagtaaagcaaaacttgaacagctaaagactgtgttagaaatgtacggg
catttttcaggcataaatcgcaaagttcagttaacgtatcttcctcatggctgcccgaag
acttccagtgaagaggaagataacagaagaaatgaaccatccctcctgctggtcctaaaa
tggggaggagaactgacccctgcaggcagggttcaagcagaggagcttggaagggcattc
aggtgtatgtatccaggtggacaaggagattatgctggatttcctggctgtggtttactt
agattacatagcacttaccgacacgatctcaaaatctatgcttctgatgagggacgagtt
cagatgactgcagcagcttttgcaaagggactactggccttagagggcgagctgactcct
attcttgtccagatggtaaaaagtgctaatatgaatggtctattggacagtgacagcgat
tctttaagcagctgtcagcatcgtgttaaagcaaggctccatgaaattctccagagagac
agagaatttactgctgatgactacgataagcttacaccatctggaagtatctcgttgata
aaatcaatgcaggttattaaaaatcccgttaaaacatgtgacaaagtctactccttgatc
cagagcttgacttctcagattaggcaaaaaatggaagaaccaaagtctgcagatattcag
ctgtaccacagtgaaacactagaactgatgctgcgcaggtgggccaagctggaaaaagac
tttaaaacaaagaatggaagatatgatattagcaaaattcctgatatttacgactgtata
aaatatgatgtgcagcacaatggctccttaaaattagaaaacacaatggagttatacagg
ctttcaaaagctttagctgacattgtgattcctcaggaatacggtatttctaaggctgag
aaactagagattgccaaaggttactgcacacctctagttagaaaaatccgttctgacctt
cagagaactcaagatgatgatactgtaaataagcttcaccctctttactccaggggtgtt
atgtcccctgaacgccatgttcgcacacgactgtatttcaccagcgaaagtcatgttcat
tccctgttatccacccttcgttatggtgccttatgtgatgaaacaaaagatgaacaatgg
aaacgagctatggattacttaaatgttgtcaatgaactcaattacatgacacagattgtt
atcatgctctatgaggatccaaataaggaactttcttcagaagaacgttttcatgtagag
ctgcactttagtccaggagccaaaggctgtgaggaagataaaaatttaccatctggatat
ggatacagacctgcctcccgagagaatgaaggctcgaagaaaacctcacatagaaatgat
agtgatgaggaggcacatacttctaaaagggatgaaaccgatcggtcagtagtgatgttc
aagccaatggtatcagacccaattcatatacacagaaagtcaccccttccaagatccagg
aagattggttctgttgaagaagagagccccctgagtgtgtctagcccagagtgtattggt
acctggctgcattacaccagtggtgtgggtactgggcgtcgaagacgcagatcaggggaa
caaatcacttcttcccctgtctcccctaaatcattggctttcacatccagtatttttggc
tcatggcaacaggtcctatcagaaagcaatagtaacttacggacaccaagaactattctg
gaacaaaagcagagtggtctagggtctcactgtgcgggcctgtttagcacctcagtgctc
gggggttcttcaagtgcacctaacctacaggattatgctcgtactcatcgtaaaaagctg
acttcttctggcttcgtagatgacaccacacgcggttctgctgttaaaaggttttctatc
tcatttgctcgacacccaaccaatggttttgaactatattccatggtgccttctatttgc
cctctggaaactcttcacaactccctgtcgctgaagcaggtggatgaatttcttgcctct
gttgctgcttcatcaaaggagaacctacaggagacatcttctccaacttatatgagtcca
ttgtcaggaagaaaaattccactgaatacatacacccctgcaaaaattcaaccaacacca
cttgaaactttgccggaaaagccagcaatagagaaaccaacctcatcttccagtgaatct
tctgtctgtgtacctgatgttaagctatctgctgaagaagcctcgctagatgcagaactt
aatagtgacactttttctgagaataagtga

DBGET integrated database retrieval system