KEGG   Gallus gallus (chicken): 427317Help
Entry
427317            CDS       T01006                                 

Gene name
DHFR
Definition
(RefSeq) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00670  One carbon pool by folate
gga00790  Folate biosynthesis
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    427317 (DHFR)
   00670 One carbon pool by folate
    427317 (DHFR)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     427317 (DHFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-GeneID: 427317
NCBI-ProteinID: NP_001006584
CGNC: 53049
Ensembl: ENSGALG00000026757
UniProt: A3RKL3
Structure
PDB: 

Position
Z
AA seq 190 aa AA seqDB search
MVRSLNSIVAVCQNMGIGKDGNLPWPPLRNEYKYFQRMTSTSHVEGKQNAVIMGKKTWFS
IPEKNRPLKDRINIVLSRELKEAPKGAHYLSKSLDDALALLDSPELKSKVDMVWIVGGTA
VYKAAMEKPINHRLFVTRILHEFESDTFFPEIDYKDFKLLTEYPGVPADIQEENGIQYKF
EVYQKSVLAQ
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgctcgctcaattccatcgtggccgtatgtcagaacatgggcatcgggaaggac
gggaacctgccctggcccccgctgaggaatgagtacaagtacttccagagaatgaccagc
acctcccatgtggaaggtaaacagaatgcagtgataatgggtaaaaaaacctggttctcc
attcctgagaagaatcgtcctctaaaagacagaattaatatagtgctcagcagggagctc
aaggaagccccaaaaggagcacattatctttctaaaagcctggatgatgccttagctctt
ttggattcaccagaattaaaaagtaaagtagacatggtttggattgttggaggcactgca
gtttataaggcagcaatggagaagcccattaatcatcgactgtttgtgacaagaatattg
catgaatttgaaagcgacacattctttccagaaatcgactacaaagacttcaaacttctc
acggaatacccaggtgtccctgctgatattcaggaagagaatggcatccagtacaaattt
gaagtgtatcaaaaatctgtcttggcacaataa

DBGET integrated database retrieval system